PDB entry 5c7n
View 5c7n on RCSB PDB site
Description: Crystal structure of the human BRPF1 bromodomain in complex with Bromosporine
Class: DNA binding protein
Keywords: DNA BINDING PROTEIN , Bromodomain and PHD finger-containing protein 1, histone acetyltransferase(HAT), transferase
Deposited on
2015-06-24, released
2015-07-08
The last revision prior to the SCOPe 2.06 freeze date was dated
2015-07-08, with a file datestamp of
2015-07-02.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Peregrin
Species: Homo sapiens [TaxId:9606]
Gene: BRPF1, BR140
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d5c7na_ - Heterogens: BMF, NO3, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>5c7nA (A:)
smemqltpflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnlea
yrylnfddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqaekmg
Sequence, based on observed residues (ATOM records): (download)
>5c7nA (A:)
mqltpflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnleayry
lnfddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqaekm