PDB entry 5c6k

View 5c6k on RCSB PDB site
Description: Bacteriophage P2 integrase catalytic domain
Class: hydrolase
Keywords: Integrase, tyrosine recombinase, integration, site-specific recombination, hydrolase
Deposited on 2015-06-23, released 2015-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-12-02, with a file datestamp of 2015-11-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integrase
    Species: ENTEROBACTERIA PHAGE P2 [TaxId:10679]
    Gene: INT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5c6ka_
  • Chain 'B':
    Compound: integrase
    Species: ENTEROBACTERIA PHAGE P2 [TaxId:10679]
    Gene: INT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5c6kb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5c6kA (A:)
    hhnkewlskptdkrrlseltqiwwdlkgkheehgksnlgkieiftkitndpcafqitksl
    isqycatrrsqgikpssinrdltcisgmftalieaelffgehpirgtkrlkeekpetgyl
    tqeeialllaaldgdnkkiailclstgarwgeaarlkaeniihnrvtfvktktnkprtvp
    iseavakmiadnkrgflfpdadyprfrrtmkaikpdlpmgqathalrhsfathfminggs
    iitlqrilghtrieqtmvyahfapeylqdaislnplrggteaesvhtvstve
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c6kA (A:)
    tgyltqeeialllaaldgdnkkiailclstgarwgeaarlkaeniihnrvtfvktktnkp
    rtvpiseavakmiadnkrgflfpdadyprfrrtmkaikpdlpmgqathalrhsfathfmi
    nggsiitlqrilghtrieqtmvyahfapeylqdaislnplrggte
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5c6kB (B:)
    hhnkewlskptdkrrlseltqiwwdlkgkheehgksnlgkieiftkitndpcafqitksl
    isqycatrrsqgikpssinrdltcisgmftalieaelffgehpirgtkrlkeekpetgyl
    tqeeialllaaldgdnkkiailclstgarwgeaarlkaeniihnrvtfvktktnkprtvp
    iseavakmiadnkrgflfpdadyprfrrtmkaikpdlpmgqathalrhsfathfminggs
    iitlqrilghtrieqtmvyahfapeylqdaislnplrggteaesvhtvstve
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c6kB (B:)
    gyltqeeialllaaldgdnkkiailclstgarwgeaarlkaeniihnrvtfvkttnkprt
    vpiseavakmiadnkrgflfpdadyprfrrtmkaikpdlpmgqathalrhsfathfming
    gsiitlqrilghtrieqtmvyahfapeylqdaislnplrggteaesv