PDB entry 5c6f

View 5c6f on RCSB PDB site
Description: Crystal structures of ferritin mutants reveal side-on binding to diiron and end-on cleavage of oxygen
Class: oxidoreductase
Keywords: ferritin, mutant, ferroxidase center, novel iron uptake route, cleavage of oxygen, OXIDOREDUCTASE
Deposited on 2015-06-23, released 2016-07-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-07-27, with a file datestamp of 2016-07-22.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bacterial non-heme ferritin
    Species: Helicobacter pylori [TaxId:85963]
    Gene: ftnA, pfr, jhp_0598
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZLI1 (6-End)
      • expression tag (0-5)
      • engineered mutation (98)
    Domains in SCOPe 2.06: d5c6fa1, d5c6fa2
  • Chain 'B':
    Compound: Bacterial non-heme ferritin
    Species: Helicobacter pylori [TaxId:85963]
    Gene: ftnA, pfr, jhp_0598
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZLI1 (6-End)
      • expression tag (0-5)
      • engineered mutation (98)
    Domains in SCOPe 2.06: d5c6fb1, d5c6fb2
  • Chain 'C':
    Compound: Bacterial non-heme ferritin
    Species: Helicobacter pylori [TaxId:85963]
    Gene: ftnA, pfr, jhp_0598
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZLI1 (6-End)
      • expression tag (0-5)
      • engineered mutation (98)
    Domains in SCOPe 2.06: d5c6fc1, d5c6fc2
  • Chain 'D':
    Compound: Bacterial non-heme ferritin
    Species: Helicobacter pylori [TaxId:85963]
    Gene: ftnA, pfr, jhp_0598
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZLI1 (6-End)
      • expression tag (0-5)
      • engineered mutation (98)
    Domains in SCOPe 2.06: d5c6fd1, d5c6fd2
  • Chain 'E':
    Compound: Bacterial non-heme ferritin
    Species: Helicobacter pylori [TaxId:85963]
    Gene: ftnA, pfr, jhp_0598
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZLI1 (6-End)
      • expression tag (0-5)
      • engineered mutation (98)
    Domains in SCOPe 2.06: d5c6fe1, d5c6fe2
  • Chain 'F':
    Compound: Bacterial non-heme ferritin
    Species: Helicobacter pylori [TaxId:85963]
    Gene: ftnA, pfr, jhp_0598
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZLI1 (6-End)
      • expression tag (0-5)
      • engineered mutation (98)
    Domains in SCOPe 2.06: d5c6ff1, d5c6ff2
  • Chain 'G':
    Compound: Bacterial non-heme ferritin
    Species: Helicobacter pylori [TaxId:85963]
    Gene: ftnA, pfr, jhp_0598
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZLI1 (6-End)
      • expression tag (0-5)
      • engineered mutation (98)
    Domains in SCOPe 2.06: d5c6fg1, d5c6fg2
  • Chain 'H':
    Compound: Bacterial non-heme ferritin
    Species: Helicobacter pylori [TaxId:85963]
    Gene: ftnA, pfr, jhp_0598
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZLI1 (6-End)
      • expression tag (0-5)
      • engineered mutation (98)
    Domains in SCOPe 2.06: d5c6fh1, d5c6fh2
  • Chain 'I':
    Compound: Bacterial non-heme ferritin
    Species: Helicobacter pylori [TaxId:85963]
    Gene: ftnA, pfr, jhp_0598
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZLI1 (6-End)
      • expression tag (0-5)
      • engineered mutation (98)
    Domains in SCOPe 2.06: d5c6fi1, d5c6fi2
  • Chain 'J':
    Compound: Bacterial non-heme ferritin
    Species: Helicobacter pylori [TaxId:85963]
    Gene: ftnA, pfr, jhp_0598
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZLI1 (6-End)
      • expression tag (0-5)
      • engineered mutation (98)
    Domains in SCOPe 2.06: d5c6fj1, d5c6fj2
  • Chain 'K':
    Compound: Bacterial non-heme ferritin
    Species: Helicobacter pylori [TaxId:85963]
    Gene: ftnA, pfr, jhp_0598
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZLI1 (6-End)
      • expression tag (0-5)
      • engineered mutation (98)
    Domains in SCOPe 2.06: d5c6fk1, d5c6fk2
  • Chain 'L':
    Compound: Bacterial non-heme ferritin
    Species: Helicobacter pylori [TaxId:85963]
    Gene: ftnA, pfr, jhp_0598
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZLI1 (6-End)
      • expression tag (0-5)
      • engineered mutation (98)
    Domains in SCOPe 2.06: d5c6fl1, d5c6fl2
  • Heterogens: FE, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5c6fA (A:)
    hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
    kkliiflnennvpvqltsisapehkfegltqifqkayeleqhisesinnivdhaikskdh
    atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrks
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c6fA (A:)
    hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
    kkliiflnennvpvqltsisapehkfegltqifqkayeleqhisesinnivdhaikskdh
    atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5c6fB (B:)
    hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
    kkliiflnennvpvqltsisapehkfegltqifqkayeleqhisesinnivdhaikskdh
    atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrks
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c6fB (B:)
    hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
    kkliiflnennvpvqltsisapehkfegltqifqkayeleqhisesinnivdhaikskdh
    atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5c6fC (C:)
    hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
    kkliiflnennvpvqltsisapehkfegltqifqkayeleqhisesinnivdhaikskdh
    atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrks
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c6fC (C:)
    hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
    kkliiflnennvpvqltsisapehkfegltqifqkayeleqhisesinnivdhaikskdh
    atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5c6fD (D:)
    hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
    kkliiflnennvpvqltsisapehkfegltqifqkayeleqhisesinnivdhaikskdh
    atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrks
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c6fD (D:)
    hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
    kkliiflnennvpvqltsisapehkfegltqifqkayeleqhisesinnivdhaikskdh
    atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5c6fE (E:)
    hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
    kkliiflnennvpvqltsisapehkfegltqifqkayeleqhisesinnivdhaikskdh
    atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrks
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c6fE (E:)
    hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
    kkliiflnennvpvqltsisapehkfegltqifqkayeleqhisesinnivdhaikskdh
    atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5c6fF (F:)
    hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
    kkliiflnennvpvqltsisapehkfegltqifqkayeleqhisesinnivdhaikskdh
    atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrks
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c6fF (F:)
    hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
    kkliiflnennvpvqltsisapehkfegltqifqkayeleqhisesinnivdhaikskdh
    atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5c6fG (G:)
    hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
    kkliiflnennvpvqltsisapehkfegltqifqkayeleqhisesinnivdhaikskdh
    atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrks
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c6fG (G:)
    hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
    kkliiflnennvpvqltsisapehkfegltqifqkayeleqhisesinnivdhaikskdh
    atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5c6fH (H:)
    hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
    kkliiflnennvpvqltsisapehkfegltqifqkayeleqhisesinnivdhaikskdh
    atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrks
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c6fH (H:)
    hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
    kkliiflnennvpvqltsisapehkfegltqifqkayeleqhisesinnivdhaikskdh
    atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5c6fI (I:)
    hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
    kkliiflnennvpvqltsisapehkfegltqifqkayeleqhisesinnivdhaikskdh
    atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrks
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c6fI (I:)
    hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
    kkliiflnennvpvqltsisapehkfegltqifqkayeleqhisesinnivdhaikskdh
    atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5c6fJ (J:)
    hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
    kkliiflnennvpvqltsisapehkfegltqifqkayeleqhisesinnivdhaikskdh
    atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrks
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c6fJ (J:)
    hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
    kkliiflnennvpvqltsisapehkfegltqifqkayeleqhisesinnivdhaikskdh
    atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5c6fK (K:)
    hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
    kkliiflnennvpvqltsisapehkfegltqifqkayeleqhisesinnivdhaikskdh
    atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrks
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c6fK (K:)
    hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
    kkliiflnennvpvqltsisapehkfegltqifqkayeleqhisesinnivdhaikskdh
    atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5c6fL (L:)
    hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
    kkliiflnennvpvqltsisapehkfegltqifqkayeleqhisesinnivdhaikskdh
    atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrks
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c6fL (L:)
    hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
    kkliiflnennvpvqltsisapehkfegltqifqkayeleqhisesinnivdhaikskdh
    atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk