PDB entry 5c67

View 5c67 on RCSB PDB site
Description: Human Mesotrypsin in complex with amyloid precursor protein inhibitor variant APPI-M17G/I18F/F34V
Class: Hyrdolase/Hydrolase inhibitor
Keywords: APPI, Kunitz domain, Trypsin, Hyrdolase-Hydrolase inhibitor complex
Deposited on 2015-06-22, released 2016-05-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-05-04, with a file datestamp of 2016-04-29.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin-3
    Species: Homo sapiens [TaxId:9606]
    Gene: PRSS3, PRSS4, TRY3, TRY4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35030 (0-223)
      • variant (107)
      • engineered mutation (176)
    Domains in SCOPe 2.06: d5c67a_
  • Chain 'B':
    Compound: Trypsin-3
    Species: Homo sapiens [TaxId:9606]
    Gene: PRSS3, PRSS4, TRY3, TRY4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35030 (0-223)
      • variant (107)
      • engineered mutation (176)
    Domains in SCOPe 2.06: d5c67b_
  • Chain 'C':
    Compound: amyloid beta a4 protein
    Species: Macaca mulatta [TaxId:9544]
    Gene: APP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29216 (12-End)
      • engineered mutation (26-27)
      • engineered mutation (43)
    Domains in SCOPe 2.06: d5c67c_
  • Chain 'E':
    Compound: amyloid beta a4 protein
    Species: Macaca mulatta [TaxId:9544]
    Gene: APP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29216 (12-End)
      • engineered mutation (26-27)
      • engineered mutation (43)
    Domains in SCOPe 2.06: d5c67e_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5c67A (A:)
    ivggytceenslpyqvslnsgshfcggsliseqwvvsaahcyktriqvrlgehnikvleg
    neqfinaakiirhpkynrdtldndimliklsspavinarvstislptappaagteclisg
    wgntlsfgadypdelkcldapvltqaeckasypgkitnsmfcvgfleggkdscqrdaggp
    vvcngqlqgvvswghgcawknrpgvytkvynyvdwikdtiaans
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5c67B (B:)
    ivggytceenslpyqvslnsgshfcggsliseqwvvsaahcyktriqvrlgehnikvleg
    neqfinaakiirhpkynrdtldndimliklsspavinarvstislptappaagteclisg
    wgntlsfgadypdelkcldapvltqaeckasypgkitnsmfcvgfleggkdscqrdaggp
    vvcngqlqgvvswghgcawknrpgvytkvynyvdwikdtiaans
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5c67C (C:)
    yvdykddddkefevcseqaetgpcragfsrwyfdvtegkcapfvyggcggnrnnfdteey
    cmavcgsaiprhhhhhhaaan
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c67C (C:)
    evcseqaetgpcragfsrwyfdvtegkcapfvyggcggnrnnfdteeycmavc
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5c67E (E:)
    yvdykddddkefevcseqaetgpcragfsrwyfdvtegkcapfvyggcggnrnnfdteey
    cmavcgsaiprhhhhhhaaan
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c67E (E:)
    evcseqaetgpcragfsrwyfdvtegkcapfvyggcggnrnnfdteeycmavcg