PDB entry 5c66

View 5c66 on RCSB PDB site
Description: E. Coli Alkaline Phosphatase in complex with tungstate
Class: hydrolase
Keywords: hydrolase
Deposited on 2015-06-22, released 2016-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-22, with a file datestamp of 2016-06-17.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alkaline phosphatase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: phoA, b0383, JW0374
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5c66a_
  • Chain 'B':
    Compound: alkaline phosphatase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: phoA, b0383, JW0374
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5c66b_
  • Heterogens: ZN, WO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5c66A (A:)
    tpempvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseita
    arnyaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngal
    gvdihekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpg
    nalekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsda
    aslnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptla
    qmtdkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkeg
    ntlvivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlria
    aygphaanvvgltdqtdlfytmkaalglksawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c66A (A:)
    nraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseitaarnyaega
    ggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngalgvdihekd
    hptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpgnalekggk
    gsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsdaaslnsvte
    anqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptlaqmtdkaie
    llsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkegntlvivta
    dhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlriaaygphaan
    vvgltdqtdlfytmkaalglk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5c66B (B:)
    tpempvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseita
    arnyaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngal
    gvdihekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpg
    nalekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsda
    aslnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptla
    qmtdkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkeg
    ntlvivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlria
    aygphaanvvgltdqtdlfytmkaalglksawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c66B (B:)
    nraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseitaarnyaega
    ggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngalgvdihekd
    hptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpgnalekggk
    gsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsdaaslnsvte
    anqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptlaqmtdkaie
    llsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkegntlvivta
    dhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlriaaygphaan
    vvgltdqtdlfytmkaalglk