PDB entry 5c5l

View 5c5l on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease variant Delta+PHS T62E / L125E at cryogenic temperature
Class: hydrolase
Keywords: nuclease, hyperstable, pdTp, ionizable group, pH-sensitive switch, HYDROLASE
Deposited on 2015-06-20, released 2015-07-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-07-08, with a file datestamp of 2015-07-02.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered mutation (43-44)
      • engineered mutation (55)
      • engineered mutation (110)
      • engineered mutation (117-118)
      • engineered mutation (121)
    Domains in SCOPe 2.05: d5c5la_
  • Heterogens: CA, THP, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5c5lA (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasafekkmv
    enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqler
    kaeaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c5lA (A:)
    lhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasafekkmvenakki
    evefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqlerkaeaqa
    kkeklniwse