PDB entry 5c5d

View 5c5d on RCSB PDB site
Description: Crystal structure of Treponema denticola PurE2-S38D
Class: lyase
Keywords: purine biosynthesis, carboxylase, lyase
Deposited on 2015-06-19, released 2016-07-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-07-06, with a file datestamp of 2016-07-01.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoribosylaminoimidazole carboxylase
    Species: Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) [TaxId:243275]
    Gene: PurE, TDE_0687
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q73PV9 (Start-158)
      • engineered mutation (37)
    Domains in SCOPe 2.07: d5c5da_
  • Chain 'B':
    Compound: phosphoribosylaminoimidazole carboxylase
    Species: Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) [TaxId:243275]
    Gene: PurE, TDE_0687
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q73PV9 (0-End)
      • engineered mutation (37)
    Domains in SCOPe 2.07: d5c5db_
  • Chain 'C':
    Compound: phosphoribosylaminoimidazole carboxylase
    Species: Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) [TaxId:243275]
    Gene: PurE, TDE_0687
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q73PV9 (0-End)
      • engineered mutation (37)
    Domains in SCOPe 2.07: d5c5dc_
  • Chain 'D':
    Compound: phosphoribosylaminoimidazole carboxylase
    Species: Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) [TaxId:243275]
    Gene: PurE, TDE_0687
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q73PV9 (0-158)
      • engineered mutation (37)
    Domains in SCOPe 2.07: d5c5dd_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5c5dA (A:)
    mrplviilmgsssdmghaekiaselktfgieyairigdahktaehvvsmlkeyealdrpk
    lyitiagrsnalsgfvdgfvkgatiacpppsdsfagadiysslrmpsgispalvlepkna
    allaarifslydkeiadsvksymesnaqkiieddsklkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c5dA (A:)
    rplviilmgsssdmghaekiaselktfgieyairigdahktaehvvsmlkeyealdrpkl
    yitiagrsnalsgfvdgfvkgatiacpppsdsfagadiysslrmpsgispalvlepknaa
    llaarifslydkeiadsvksymesnaqkiieddsklkr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5c5dB (B:)
    mrplviilmgsssdmghaekiaselktfgieyairigdahktaehvvsmlkeyealdrpk
    lyitiagrsnalsgfvdgfvkgatiacpppsdsfagadiysslrmpsgispalvlepkna
    allaarifslydkeiadsvksymesnaqkiieddsklkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c5dB (B:)
    mrplviilmgsssdmghaekiaselktfgieyairigdahktaehvvsmlkeyealdrpk
    lyitiagrsnalsgfvdgfvkgatiacpppsdsfagadiysslrmpsgispalvlepkna
    allaarifslydkeiadsvksymesnaqkiieddsklk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5c5dC (C:)
    mrplviilmgsssdmghaekiaselktfgieyairigdahktaehvvsmlkeyealdrpk
    lyitiagrsnalsgfvdgfvkgatiacpppsdsfagadiysslrmpsgispalvlepkna
    allaarifslydkeiadsvksymesnaqkiieddsklkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c5dC (C:)
    mrplviilmgsssdmghaekiaselktfgieyairigdahktaehvvsmlkeyealdrpk
    lyitiagrsnalsgfvdgfvkgatiacpppsdsfagadiysslrmpsgispalvlepkna
    allaarifslydkeiadsvksymesnaqkiieddsklk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5c5dD (D:)
    mrplviilmgsssdmghaekiaselktfgieyairigdahktaehvvsmlkeyealdrpk
    lyitiagrsnalsgfvdgfvkgatiacpppsdsfagadiysslrmpsgispalvlepkna
    allaarifslydkeiadsvksymesnaqkiieddsklkr