PDB entry 5c5a

View 5c5a on RCSB PDB site
Description: Crystal Structure of HDM2 in complex with Nutlin-3a
Class: ligase
Keywords: Drug Design, HDM2, complex structure, ligase
Deposited on 2015-06-19, released 2016-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-29, with a file datestamp of 2016-06-24.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: N/A
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5c5aa_
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5c5ab_
  • Heterogens: NUT, SO4, CL, IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5c5aA (A:)
    paseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsn
    dllgdlfgvpsfsvkehrkiytmiyrnlvvvn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5c5aB (B:)
    paseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsn
    dllgdlfgvpsfsvkehrkiytmiyrnlvvvn