PDB entry 5c4o

View 5c4o on RCSB PDB site
Description: Identification of a Novel Allosteric Binding Site for RORgt Inhibitors
Class: transcription/transcription inhibitor
Keywords: Allosteric, Inhibitor, TRANSCRIPTION-TRANSCRIPTION INHIBITOR complex
Deposited on 2015-06-18, released 2015-12-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-12-16, with a file datestamp of 2015-12-11.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449 (0-240)
      • conflict (188)
    Domains in SCOPe 2.07: d5c4oa_
  • Heterogens: 4F1, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5c4oA (A:)
    lteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlte
    aiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggme
    lfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqynl
    elafhhhlhkthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpplykelf
    s