PDB entry 5c3t

View 5c3t on RCSB PDB site
Description: PD-1 binding domain from human PD-L1
Class: immune system
Keywords: immunology, ligand, PD1/PDL1 axis, immune system
Deposited on 2015-06-17, released 2015-11-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-12-16, with a file datestamp of 2015-12-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Programmed cell death 1 ligand 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CD274, B7H1, PDCD1L1, PDCD1LG1, PDL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NZQ7 (0-116)
      • engineered mutation (29)
      • expression tag (117-125)
    Domains in SCOPe 2.08: d5c3ta1, d5c3ta2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5c3tA (A:)
    aftvtvpkdlyvveygsnmtieckfpvekeldlaalivywemedkniiqfvhgeedlkvq
    hssyrqrarllkdqlslgnaalqitdvklqdagvyrcmisyggadykritvkvnapyaaa
    lehhhh