PDB entry 5c3s

View 5c3s on RCSB PDB site
Description: Crystal structure of the full-length Neurospora crassa T7H in complex with alpha-KG and 5-formyluracil (5fU)
Class: oxidoreductase
Keywords: dioxygenase, substrate C, DSBH fold, OXIDOREDUCTASE
Deposited on 2015-06-17, released 2015-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-12-02, with a file datestamp of 2015-11-27.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thymine dioxygenase
    Species: Neurospora crassa [TaxId:5141]
    Gene: NCU06416
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7RYZ9 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d5c3sa1, d5c3sa2
  • Chain 'B':
    Compound: Thymine dioxygenase
    Species: Neurospora crassa [TaxId:5141]
    Gene: NCU06416
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5c3sb_
  • Chain 'C':
    Compound: Thymine dioxygenase
    Species: Neurospora crassa [TaxId:5141]
    Gene: NCU06416
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5c3sc_
  • Chain 'D':
    Compound: Thymine dioxygenase
    Species: Neurospora crassa [TaxId:5141]
    Gene: NCU06416
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5c3sd_
  • Heterogens: NI, AKG, FYU, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5c3sA (A:)
    gsmekaavnedglviplidfskflegdetlkletakailhgfqtagfiylknipiqpdfr
    ehvfntsakffklpkekklevgwttpeanrgysapgrekvtqltdpaeiekirsaapdik
    esyeigredepghpnpwpaeqddlvgfkstmnnffdqckalhievmraiavgmgidanyf
    dsfvdvgdnilrllhypavksevfkinpgqvragehtdygsitllfqdsrgglqvkspng
    qfidatpientvvvnagdllarwsndtikstvhrvveppkqedvhpprysiayfcnpnhk
    syieaipgtyaaeserkyeginsgkylvqrlaatylehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c3sA (A:)
    gsmekaavnedglviplidfskflegdetlkletakailhgfqtagfiylknipiqpdfr
    ehvfntsakffklpkekklevgwttpeanrgysapgrekvtqltdpaeiekirsaapdik
    esyeigredepghpnpwpaeqddlvgfkstmnnffdqckalhievmraiavgmgidanyf
    dsfvdvgdnilrllhypavksevfkinpgqvragehtdygsitllfqdsrgglqvkspng
    qfidatpientvvvnagdllarwsndtikstvhrvveppkqedvhpprysiayfcnpnhk
    syieaipgtyaaeserkyeginsgkylvqrlaat
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5c3sB (B:)
    gsmekaavnedglviplidfskflegdetlkletakailhgfqtagfiylknipiqpdfr
    ehvfntsakffklpkekklevgwttpeanrgysapgrekvtqltdpaeiekirsaapdik
    esyeigredepghpnpwpaeqddlvgfkstmnnffdqckalhievmraiavgmgidanyf
    dsfvdvgdnilrllhypavksevfkinpgqvragehtdygsitllfqdsrgglqvkspng
    qfidatpientvvvnagdllarwsndtikstvhrvveppkqedvhpprysiayfcnpnhk
    syieaipgtyaaeserkyeginsgkylvqrlaatylehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c3sB (B:)
    mekaavnedglviplidfskflegdetlkletakailhgfqtagfiylknipiqpdfreh
    vfntsakffklpkekklevgwttpeanrgysapdikesyeigredepghpnpwpaeqddl
    vgfkstmnnffdqckalhievmraiavgmgidanyfdsfvdvgdnilrllhypavksevf
    kinpgqvragehtdygsitllfqdsrgglqvkspngqfidatpientvvvnagdllarws
    ndtikstvhrvveppkqedvhpprysiayfcnpnhksyieaipgtyaaeserkyeginsg
    kylvqrlaat
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5c3sC (C:)
    gsmekaavnedglviplidfskflegdetlkletakailhgfqtagfiylknipiqpdfr
    ehvfntsakffklpkekklevgwttpeanrgysapgrekvtqltdpaeiekirsaapdik
    esyeigredepghpnpwpaeqddlvgfkstmnnffdqckalhievmraiavgmgidanyf
    dsfvdvgdnilrllhypavksevfkinpgqvragehtdygsitllfqdsrgglqvkspng
    qfidatpientvvvnagdllarwsndtikstvhrvveppkqedvhpprysiayfcnpnhk
    syieaipgtyaaeserkyeginsgkylvqrlaatylehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c3sC (C:)
    mekaavnedglviplidfskflegdetlkletakailhgfqtagfiylknipiqpdfreh
    vfntsakffklpkekklevgwttpeanrgysappdikesyeigredepghpnpwpaeqdd
    lvgfkstmnnffdqckalhievmraiavgmgidanyfdsfvdvgdnilrllhypavksev
    fkinpgqvragehtdygsitllfqdsrgglqvkspngqfidatpientvvvnagdllarw
    sndtikstvhrvveppkqedvhpprysiayfcnpnhksyieaipgtyaaeserkyegins
    gkylvqrlaat
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5c3sD (D:)
    gsmekaavnedglviplidfskflegdetlkletakailhgfqtagfiylknipiqpdfr
    ehvfntsakffklpkekklevgwttpeanrgysapgrekvtqltdpaeiekirsaapdik
    esyeigredepghpnpwpaeqddlvgfkstmnnffdqckalhievmraiavgmgidanyf
    dsfvdvgdnilrllhypavksevfkinpgqvragehtdygsitllfqdsrgglqvkspng
    qfidatpientvvvnagdllarwsndtikstvhrvveppkqedvhpprysiayfcnpnhk
    syieaipgtyaaeserkyeginsgkylvqrlaatylehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c3sD (D:)
    kaavnedglviplidfskflegdetlkletakailhgfqtagfiylknipiqpdfrehvf
    ntsakffklpkekklevgwttpeanrgysapgrekvtqltdpaeiekirsaapdikesye
    igredepghpnpwpaeqddlvgfkstmnnffdqckalhievmraiavgmgidanyfdsfv
    dvgdnilrllhypavksevfkinpgqvragehtdygsitllfqdsrgglqvkspngqfid
    atpientvvvnagdllarwsndtikstvhrvveppkqedvhpprysiayfcnpnhksyie
    aipgtyaaeserkyeginsgkylvqrlaa