PDB entry 5c2u

View 5c2u on RCSB PDB site
Description: Ferredoxin-like domain of nucleoporin Nup54 bound to a nanobody
Class: transport protein
Keywords: Nucleoporin Nup54, Nup54 alpha-beta domain, Ferredoxin-like fold, transport protein
Deposited on 2015-06-16, released 2015-08-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-10-14, with a file datestamp of 2015-10-09.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nup54
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot K9ZTJ6
      • conflict (97)
  • Chain 'B':
    Compound: Nanobody
    Species: Camelus dromedarius [TaxId:9838]
    Gene: Immunoglobulin G
    Database cross-references and differences (RAF-indexed):
    • PDB 5C2U (Start-130)
    Domains in SCOPe 2.07: d5c2ub_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5c2uB (B:)
    agtgsgqvqlqesggglvqpggslrlscvvsgdyyaigwfrqapgkeregvaaissrdgs
    tyypdavkgrftisrdnakntvylqmnslkpedtavyycaadrrqrwgpyyylsaleyvy
    wgqgtqvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c2uB (B:)
    vqlqesggglvqpggslrlscvvsgdyyaigwfrqapgkeregvaaissrdgstyypdav
    kgrftisrdnakntvylqmnslkpedtavyycaadrrqrwgpyyylsaleyvywgqgtqv
    tvss