PDB entry 5c2j

View 5c2j on RCSB PDB site
Description: Complex structure of the GAP domain of MgcRacGAP and Cdc42
Class: hydrolase activator/signaling protein
Keywords: GTPase activation, Complex, small G-protein, HYDROLASE ACTIVATOR-SIGNALING PROTEIN complex
Deposited on 2015-06-16, released 2016-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-22, with a file datestamp of 2016-06-17.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rac GTPase-activating protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RACGAP1, KIAA1478, MGCRACGAP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H0H5 (7-207)
      • see sequence details (179)
  • Chain 'B':
    Compound: Cell division control protein 42 homolog
    Species: Mus musculus [TaxId:10090]
    Gene: CDC42
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5c2jb_
  • Heterogens: MG, GDP, AF3, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5c2jB (B:)
    gssgssgmqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytl
    glfdtagqedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllv
    gtqidlrddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeai
    laaleppepkksrrcvll
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c2jB (B:)
    mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
    qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
    ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepp
    epkksrrcvll