PDB entry 5c2e

View 5c2e on RCSB PDB site
Description: PDE10 complexed with6-chloro-N-[(2,4-dimethylthiazol-5-yl)methyl]-5-methyl-2-[2-(2-pyridyl)ethoxy]pyrimidin-4-amine
Class: hydrolase/hydrolase inhibitor
Keywords: Phosphodiesterase, inhibitor, complex, hydrolase-hydrolase inhibitor complex
Deposited on 2015-06-15, released 2015-12-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-12-02, with a file datestamp of 2015-11-27.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE10A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y233 (21-End)
      • expression tag (19-20)
    Domains in SCOPe 2.07: d5c2ea1, d5c2ea2
  • Chain 'B':
    Compound: cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE10A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y233 (21-End)
      • expression tag (19-20)
    Domains in SCOPe 2.07: d5c2eb1, d5c2eb2
  • Heterogens: ZN, MG, 4PX, 4Y1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5c2eA (A:)
    mgsshhhhhhssglvprgshmsictseewqglmqftlpvrlckeielfhfdigpfenmwp
    gifvymvhrscgtscfeleklcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtl
    ftdlerkglliaclchdldhrgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleg
    hnifstlssseyeqvleiirkaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrvig
    lmmtacdlcsvtklwpvtkltandiyaefwaegdemkklgiqpipmmdrdkkdevpqgql
    gfynavaipcyttltqilpptepllkacrdnlsqwekvirgeetatwisspsvaqkaaas
    ed
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c2eA (A:)
    hmsictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfele
    klcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdld
    hrgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleii
    rkaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtk
    ltandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilp
    ptepllkacrdnlsqwekvirge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5c2eB (B:)
    mgsshhhhhhssglvprgshmsictseewqglmqftlpvrlckeielfhfdigpfenmwp
    gifvymvhrscgtscfeleklcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtl
    ftdlerkglliaclchdldhrgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleg
    hnifstlssseyeqvleiirkaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrvig
    lmmtacdlcsvtklwpvtkltandiyaefwaegdemkklgiqpipmmdrdkkdevpqgql
    gfynavaipcyttltqilpptepllkacrdnlsqwekvirgeetatwisspsvaqkaaas
    ed
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c2eB (B:)
    hmsictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfele
    klcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdld
    hrgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleii
    rkaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtk
    ltandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilp
    ptepllkacrdnlsqwekvirge