PDB entry 5c2a

View 5c2a on RCSB PDB site
Description: PDE10 complexed with 6-chloro-2-cyclopropyl-N-[(2,4-dimethylthiazol-5-yl)methyl]-5-methyl-pyrimidin-4-amine
Class: hydrolase/hydrolase inhibitor
Keywords: phosphodiesterase, inhibitor, complex, hydrolase-hydrolase inhibitor complex
Deposited on 2015-06-15, released 2015-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-10-21, with a file datestamp of 2015-10-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE10A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y233 (21-End)
      • expression tag (19-20)
    Domains in SCOPe 2.07: d5c2aa1, d5c2aa2
  • Chain 'B':
    Compound: cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE10A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y233 (21-End)
      • expression tag (19-20)
    Domains in SCOPe 2.07: d5c2ab1, d5c2ab2
  • Heterogens: ZN, MG, 4Y2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5c2aA (A:)
    mgsshhhhhhssglvprgshmsictseewqglmqftlpvrlckeielfhfdigpfenmwp
    gifvymvhrscgtscfeleklcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtl
    ftdlerkglliaclchdldhrgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleg
    hnifstlssseyeqvleiirkaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrvig
    lmmtacdlcsvtklwpvtkltandiyaefwaegdemkklgiqpipmmdrdkkdevpqgql
    gfynavaipcyttltqilpptepllkacrdnlsqwekvirgeetatwisspsvaqkaaas
    ed
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c2aA (A:)
    hmsictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfele
    klcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdld
    hrgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleii
    rkaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtk
    ltandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilp
    ptepllkacrdnlsqwekvirge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5c2aB (B:)
    mgsshhhhhhssglvprgshmsictseewqglmqftlpvrlckeielfhfdigpfenmwp
    gifvymvhrscgtscfeleklcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtl
    ftdlerkglliaclchdldhrgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleg
    hnifstlssseyeqvleiirkaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrvig
    lmmtacdlcsvtklwpvtkltandiyaefwaegdemkklgiqpipmmdrdkkdevpqgql
    gfynavaipcyttltqilpptepllkacrdnlsqwekvirgeetatwisspsvaqkaaas
    ed
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c2aB (B:)
    hmsictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfele
    klcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdld
    hrgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleii
    rkaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtk
    ltandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilp
    ptepllkacrdnlsqwekvirge