PDB entry 5c27

View 5c27 on RCSB PDB site
Description: Crystal structure of SYK in complex with compound 2
Class: transferase/inhibitor
Keywords: Spleen Tyrosine Kinase, Inhibitor, TRANSFERASE-INHIBITOR complex
Deposited on 2015-06-15, released 2015-10-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-02-03, with a file datestamp of 2016-01-29.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase SYK
    Species: Homo sapiens [TaxId:9606]
    Gene: SYK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43405 (Start-292)
      • expression tag (293)
    Domains in SCOPe 2.07: d5c27a1, d5c27a2
  • Chain 'D':
    Compound: glu-val-tyr-glu-ser
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5C27 (0-4)
  • Heterogens: 50J, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5c27A (A:)
    mdtevyespyadpeeirpkevyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavk
    ilkneandpalkdellaeanvmqqldnpyivrmigiceaeswmlvmemaelgplnkylqq
    nrhvkdkniielvhqvsmgmkyleesnfvhrdlaarnvllvtqhyakisdfglskalrad
    enyykaqthgkwpvkwyapecinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevt
    amlekgermgcpagcpremydlmnlcwtydvenrpgfaavelrlrnyyydvvnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c27A (A:)
    vyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpalkdellaean
    vmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgm
    kyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyape
    cinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremy
    dlmnlcwtydvenrpgfaavelrlrnyyydvvnh
    

  • Chain 'D':
    No sequence available.