PDB entry 5c1q

View 5c1q on RCSB PDB site
Description: Serine/threonine-protein kinase pim-1
Class: transferase
Keywords: protein-ligand complex, TRANSFERASE
Deposited on 2015-06-15, released 2015-12-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-12-16, with a file datestamp of 2015-12-11.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Serine/threonine-protein kinase pim-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PIM1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5c1qb_
  • Heterogens: 4YK

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5c1qB (B:)
    gphmkekeplesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngt
    rvpmevvllkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeela
    rsffwqvleavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgt
    rvysppewiryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecq
    hlirwclalrpsdrptfeeiqnhpwmqdvllpqetaeihlhslspgpsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c1qB (B:)
    plesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvl
    lkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvl
    eavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppew
    iryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcla
    lrpsdrptfeeiqnhpwmqdvllpqetaeihlh