PDB entry 5c1m

View 5c1m on RCSB PDB site
Description: Crystal structure of active mu-opioid receptor bound to the agonist BU72
Class: Signaling Protein/antagonist
Keywords: Ligands, Mice, Agonists, Morphinans, Activation, Receptors, Opioid, mu, Nanobody, Signaling Protein-antagonist complex
Deposited on 2015-06-15, released 2015-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mu-type opioid receptor
    Species: Mus musculus [TaxId:10090]
    Gene: Oprm1, Mor, Oprm
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Nanobody 39
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 5C1M (0-124)
    Domains in SCOPe 2.07: d5c1mb_
  • Heterogens: 4VO, OLC, CLR, PO4, P6G, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5c1mB (B:)
    qvqlvesggglvrpggslrlscvdsertsypmgwfrrapgkerefvasitwsgidptyad
    svadrfttsrdvanntlylqmnslkhedtavyycaarapvgqssspydydywgqgtqvtv
    ssaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c1mB (B:)
    qvqlvesggglvrpggslrlscvdsertsypmgwfrrapgkerefvasitwsgidptyad
    svadrfttsrdvanntlylqmnslkhedtavyycaarapvdydywgqgtqvtvssaaa