PDB entry 5byv

View 5byv on RCSB PDB site
Description: Crystal structure of MSM-13, a putative T1-like thiolase from Mycobacterium smegmatis
Class: transferase
Keywords: thiolase, mycobacterium smegmatis, T1-like, tetrameric, TRANSFERASE
Deposited on 2015-06-11, released 2016-05-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-05-18, with a file datestamp of 2016-05-13.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-ketothiolase
    Species: Mycobacterium smegmatis str. MC2 155 [TaxId:246196]
    Gene: MSMEG_2207
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5byva1, d5byva2
  • Chain 'B':
    Compound: Beta-ketothiolase
    Species: Mycobacterium smegmatis str. MC2 155 [TaxId:246196]
    Gene: MSMEG_2207
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5byvb1, d5byvb2
  • Chain 'C':
    Compound: Beta-ketothiolase
    Species: Mycobacterium smegmatis str. MC2 155 [TaxId:246196]
    Gene: MSMEG_2207
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5byvc1, d5byvc2
  • Chain 'D':
    Compound: Beta-ketothiolase
    Species: Mycobacterium smegmatis str. MC2 155 [TaxId:246196]
    Gene: MSMEG_2207
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5byvd1, d5byvd2
  • Chain 'E':
    Compound: Beta-ketothiolase
    Species: Mycobacterium smegmatis str. MC2 155 [TaxId:246196]
    Gene: MSMEG_2207
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5byve1, d5byve2
  • Chain 'F':
    Compound: Beta-ketothiolase
    Species: Mycobacterium smegmatis str. MC2 155 [TaxId:246196]
    Gene: MSMEG_2207
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5byvf1, d5byvf2
  • Chain 'G':
    Compound: Beta-ketothiolase
    Species: Mycobacterium smegmatis str. MC2 155 [TaxId:246196]
    Gene: MSMEG_2207
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5byvg1, d5byvg2
  • Chain 'H':
    Compound: Beta-ketothiolase
    Species: Mycobacterium smegmatis str. MC2 155 [TaxId:246196]
    Gene: MSMEG_2207
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5byvh1, d5byvh2
  • Chain 'J':
    Compound: Beta-ketothiolase
    Species: Mycobacterium smegmatis str. MC2 155 [TaxId:246196]
    Gene: MSMEG_2207
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5byvj1, d5byvj2
  • Chain 'K':
    Compound: Beta-ketothiolase
    Species: Mycobacterium smegmatis str. MC2 155 [TaxId:246196]
    Gene: MSMEG_2207
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5byvk1, d5byvk2
  • Chain 'L':
    Compound: Beta-ketothiolase
    Species: Mycobacterium smegmatis str. MC2 155 [TaxId:246196]
    Gene: MSMEG_2207
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5byvl1, d5byvl2
  • Chain 'M':
    Compound: Beta-ketothiolase
    Species: Mycobacterium smegmatis str. MC2 155 [TaxId:246196]
    Gene: MSMEG_2207
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5byvm1, d5byvm2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5byvA (A:)
    msmrdavicepvrtpigryggmfrsltavdlgvtalkgllertgiaadqvedvilghcyp
    nseapaigrvvaldaglpitvpgmqvdrrcgsglqaviqaclqvrsgdhdlvvaggaesm
    snvafystdmrwggartgvqihdglargrttaggkfhpvpggmletaenlrreyhisrte
    qdelavrshqravaaqsegvlaeeiipvpvrtrdgeetisvdehpradttvealaklkpv
    llkqdpeatvtagnssgqndaasmcivttpekaaelglkplvrlvswgsagvapdlmgig
    pvpatevalakagltladidlielneafaaqalavmrewkfgeadhertnvrgsgislgh
    pvgatggrmlatlarelhrrearygletmcigggqglaavfervqeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5byvA (A:)
    rdavicepvrtpigryggmfrsltavdlgvtalkgllertgiaadqvedvilghcypnse
    apaigrvvaldaglpitvpgmqvdrrcgsglqaviqaclqvrsgdhdlvvaggaesmsnv
    afystdmrwggartgvqihdglargrttaggkfhpvpggmletaenlrreyhisrteqde
    lavrshqravaaqsegvlaeeiipvpvretisvdehpradttvealaklkpvllkqdpea
    tvtagnssgqndaasmcivttpekaaelglkplvrlvswgsagvapdlmgigpvpateva
    lakagltladidlielneafaaqalavmrewkfgeadhertnvrgsgislghpvgatggr
    mlatlarelhrrearygletmcigggqglaavferv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5byvB (B:)
    msmrdavicepvrtpigryggmfrsltavdlgvtalkgllertgiaadqvedvilghcyp
    nseapaigrvvaldaglpitvpgmqvdrrcgsglqaviqaclqvrsgdhdlvvaggaesm
    snvafystdmrwggartgvqihdglargrttaggkfhpvpggmletaenlrreyhisrte
    qdelavrshqravaaqsegvlaeeiipvpvrtrdgeetisvdehpradttvealaklkpv
    llkqdpeatvtagnssgqndaasmcivttpekaaelglkplvrlvswgsagvapdlmgig
    pvpatevalakagltladidlielneafaaqalavmrewkfgeadhertnvrgsgislgh
    pvgatggrmlatlarelhrrearygletmcigggqglaavfervqeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5byvB (B:)
    rdavicepvrtpigryggmfrsltavdlgvtalkgllertgiaadqvedvilghcypnse
    apaigrvvaldaglpitvpgmqvdrrcgsglqaviqaclqvrsgdhdlvvaggaesmsnv
    afystdmrwggartgvqihdglargrttaggkfhpvpggmletaenlrreyhisrteqde
    lavrshqravaaqsegvlaeeiipvpvrteetisvdehpradttvealaklkpvllkqdp
    eatvtagnssgqndaasmcivttpekaaelglkplvrlvswgsagvapdlmgigpvpate
    valakagltladidlielneafaaqalavmrewkfgeadhertnvrgsgislghpvgatg
    grmlatlarelhrrearygletmcigggqglaavferv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5byvC (C:)
    msmrdavicepvrtpigryggmfrsltavdlgvtalkgllertgiaadqvedvilghcyp
    nseapaigrvvaldaglpitvpgmqvdrrcgsglqaviqaclqvrsgdhdlvvaggaesm
    snvafystdmrwggartgvqihdglargrttaggkfhpvpggmletaenlrreyhisrte
    qdelavrshqravaaqsegvlaeeiipvpvrtrdgeetisvdehpradttvealaklkpv
    llkqdpeatvtagnssgqndaasmcivttpekaaelglkplvrlvswgsagvapdlmgig
    pvpatevalakagltladidlielneafaaqalavmrewkfgeadhertnvrgsgislgh
    pvgatggrmlatlarelhrrearygletmcigggqglaavfervqeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5byvC (C:)
    rdavicepvrtpigryggmfrsltavdlgvtalkgllertgiaadqvedvilghcypnse
    apaigrvvaldaglpitvpgmqvdrrcgsglqaviqaclqvrsgdhdlvvaggaesmsnv
    afystdmrwggartgvqihdglargrttaggkfhpvpggmletaenlrreyhisrteqde
    lavrshqravaaqsegvlaeeiipvpvrteetisvdehpradttvealaklkpvllkqdp
    eatvtagnssgqndaasmcivttpekaaelglkplvrlvswgsagvapdlmgigpvpate
    valakagltladidlielneafaaqalavmrewkfgeadhertnvrgsgislghpvgatg
    grmlatlarelhrrearygletmcigggqglaavferv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5byvD (D:)
    msmrdavicepvrtpigryggmfrsltavdlgvtalkgllertgiaadqvedvilghcyp
    nseapaigrvvaldaglpitvpgmqvdrrcgsglqaviqaclqvrsgdhdlvvaggaesm
    snvafystdmrwggartgvqihdglargrttaggkfhpvpggmletaenlrreyhisrte
    qdelavrshqravaaqsegvlaeeiipvpvrtrdgeetisvdehpradttvealaklkpv
    llkqdpeatvtagnssgqndaasmcivttpekaaelglkplvrlvswgsagvapdlmgig
    pvpatevalakagltladidlielneafaaqalavmrewkfgeadhertnvrgsgislgh
    pvgatggrmlatlarelhrrearygletmcigggqglaavfervqeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5byvD (D:)
    rdavicepvrtpigryggmfrsltavdlgvtalkgllertgiaadqvedvilghcypnse
    apaigrvvaldaglpitvpgmqvdrrcgsglqaviqaclqvrsgdhdlvvaggaesmsnv
    afystdmrwggartgvqihdglargrttaggkfhpvpggmletaenlrreyhisrteqde
    lavrshqravaaqsegvlaeeiipvpvretisvdehpradttvealaklkpvllkqdpea
    tvtagnssgqndaasmcivttpekaaelglkplvrlvswgsagvapdlmgigpvpateva
    lakagltladidlielneafaaqalavmrewkfgeadhertnvrgsgislghpvgatggr
    mlatlarelhrrearygletmcigggqglaavferv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5byvE (E:)
    msmrdavicepvrtpigryggmfrsltavdlgvtalkgllertgiaadqvedvilghcyp
    nseapaigrvvaldaglpitvpgmqvdrrcgsglqaviqaclqvrsgdhdlvvaggaesm
    snvafystdmrwggartgvqihdglargrttaggkfhpvpggmletaenlrreyhisrte
    qdelavrshqravaaqsegvlaeeiipvpvrtrdgeetisvdehpradttvealaklkpv
    llkqdpeatvtagnssgqndaasmcivttpekaaelglkplvrlvswgsagvapdlmgig
    pvpatevalakagltladidlielneafaaqalavmrewkfgeadhertnvrgsgislgh
    pvgatggrmlatlarelhrrearygletmcigggqglaavfervqeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5byvE (E:)
    rdavicepvrtpigryggmfrsltavdlgvtalkgllertgiaadqvedvilghcypnse
    apaigrvvaldaglpitvpgmqvdrrcgsglqaviqaclqvrsgdhdlvvaggaesmsnv
    afystdmrwggartgvqihdglargrttaggkfhpvpggmletaenlrreyhisrteqde
    lavrshqravaaqsegvlaeeiipvpvreetisvdehpradttvealaklkpvlkqdpea
    tvtagnssgqndaasmcivttpekaaelglkplvrlvswgsagvapdlmgigpvpateva
    lakagltladidlielneafaaqalavmrewkfgeadhertnvrgsgislghpvgatggr
    mlatlarelhrrearygletmcigggqglaavferv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5byvF (F:)
    msmrdavicepvrtpigryggmfrsltavdlgvtalkgllertgiaadqvedvilghcyp
    nseapaigrvvaldaglpitvpgmqvdrrcgsglqaviqaclqvrsgdhdlvvaggaesm
    snvafystdmrwggartgvqihdglargrttaggkfhpvpggmletaenlrreyhisrte
    qdelavrshqravaaqsegvlaeeiipvpvrtrdgeetisvdehpradttvealaklkpv
    llkqdpeatvtagnssgqndaasmcivttpekaaelglkplvrlvswgsagvapdlmgig
    pvpatevalakagltladidlielneafaaqalavmrewkfgeadhertnvrgsgislgh
    pvgatggrmlatlarelhrrearygletmcigggqglaavfervqeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5byvF (F:)
    rdavicepvrtpigryggmfrsltavdlgvtalkgllertgiaadqvedvilghcypnse
    apaigrvvaldaglpitvpgmqvdrrcgsglqaviqaclqvrsgdhdlvvaggaesmsnv
    afystdmrwggartgvqihdglargrttaggkfhpvpggmletaenlrreyhisrteqde
    lavrshqravaaqsegvlaeeiipvpvrteetisvdehpradttvealaklkpvllkqdp
    eatvtagnssgqndaasmcivttpekaaelglkplvrlvswgsagvapdlmgigpvpate
    valakagltladidlielneafaaqalavmrewkfgeadhertnvrgsgislghpvgatg
    grmlatlarelhrrearygletmcigggqglaavfervq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5byvG (G:)
    msmrdavicepvrtpigryggmfrsltavdlgvtalkgllertgiaadqvedvilghcyp
    nseapaigrvvaldaglpitvpgmqvdrrcgsglqaviqaclqvrsgdhdlvvaggaesm
    snvafystdmrwggartgvqihdglargrttaggkfhpvpggmletaenlrreyhisrte
    qdelavrshqravaaqsegvlaeeiipvpvrtrdgeetisvdehpradttvealaklkpv
    llkqdpeatvtagnssgqndaasmcivttpekaaelglkplvrlvswgsagvapdlmgig
    pvpatevalakagltladidlielneafaaqalavmrewkfgeadhertnvrgsgislgh
    pvgatggrmlatlarelhrrearygletmcigggqglaavfervqeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5byvG (G:)
    rdavicepvrtpigryggmfrsltavdlgvtalkgllertgiaadqvedvilghcypnse
    apaigrvvaldaglpitvpgmqvdrrcgsglqaviqaclqvrsgdhdlvvaggaesmsnv
    afystdmrwggartgvqihdglargrttaggkfhpvpggmletaenlrreyhisrteqde
    lavrshqravaaqsegvlaeeiipvpvrteetisvdehpradttvealaklkpvllkqdp
    eatvtagnssgqndaasmcivttpekaaelglkplvrlvswgsagvapdlmgigpvpate
    valakagltladidlielneafaaqalavmrewkfgeadhertnvrgsgislghpvgatg
    grmlatlarelhrrearygletmcigggqglaavferv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5byvH (H:)
    msmrdavicepvrtpigryggmfrsltavdlgvtalkgllertgiaadqvedvilghcyp
    nseapaigrvvaldaglpitvpgmqvdrrcgsglqaviqaclqvrsgdhdlvvaggaesm
    snvafystdmrwggartgvqihdglargrttaggkfhpvpggmletaenlrreyhisrte
    qdelavrshqravaaqsegvlaeeiipvpvrtrdgeetisvdehpradttvealaklkpv
    llkqdpeatvtagnssgqndaasmcivttpekaaelglkplvrlvswgsagvapdlmgig
    pvpatevalakagltladidlielneafaaqalavmrewkfgeadhertnvrgsgislgh
    pvgatggrmlatlarelhrrearygletmcigggqglaavfervqeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5byvH (H:)
    rdavicepvrtpigryggmfrsltavdlgvtalkgllertgiaadqvedvilghcypnse
    apaigrvvaldaglpitvpgmqvdrrcgsglqaviqaclqvrsgdhdlvvaggaesmsnv
    afystdmrwggartgvqihdglargrttaggkfhpvpggmletaenlrreyhisrteqde
    lavrshqravaaqsegvlaeeiipvpvretisvdehpradttvealaklkpvllkqdpea
    tvtagnssgqndaasmcivttpekaaelglkplvrlvswgsagvapdlmgigpvpateva
    lakagltladidlielneafaaqalavmrewkfgeadhertnvrgsgislghpvgatggr
    mlatlarelhrrearygletmcigggqglaavfervq
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5byvJ (J:)
    msmrdavicepvrtpigryggmfrsltavdlgvtalkgllertgiaadqvedvilghcyp
    nseapaigrvvaldaglpitvpgmqvdrrcgsglqaviqaclqvrsgdhdlvvaggaesm
    snvafystdmrwggartgvqihdglargrttaggkfhpvpggmletaenlrreyhisrte
    qdelavrshqravaaqsegvlaeeiipvpvrtrdgeetisvdehpradttvealaklkpv
    llkqdpeatvtagnssgqndaasmcivttpekaaelglkplvrlvswgsagvapdlmgig
    pvpatevalakagltladidlielneafaaqalavmrewkfgeadhertnvrgsgislgh
    pvgatggrmlatlarelhrrearygletmcigggqglaavfervqeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5byvJ (J:)
    rdavicepvrtpigryggmfrsltavdlgvtalkgllertgiaadqvedvilghcypnse
    apaigrvvaldaglpitvpgmqvdrrcgsglqaviqaclqvrsgdhdlvvaggaesmsnv
    afystdmrwggartgvqihdglargrttaggkfhpvpggmletaenlrreyhisrteqde
    lavrshqravaaqsegvlaeeiipvpvreetisvdehpradttvealaklkpvlkqdpea
    tvtagnssgqndaasmcivttpekaaelglkplvrlvswgsagvapdlmgigpvpateva
    lakagltladidlielneafaaqalavmrewkfgeadhertnvrgsgislghpvgatggr
    mlatlarelhrrearygletmcigggqglaavferv
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5byvK (K:)
    msmrdavicepvrtpigryggmfrsltavdlgvtalkgllertgiaadqvedvilghcyp
    nseapaigrvvaldaglpitvpgmqvdrrcgsglqaviqaclqvrsgdhdlvvaggaesm
    snvafystdmrwggartgvqihdglargrttaggkfhpvpggmletaenlrreyhisrte
    qdelavrshqravaaqsegvlaeeiipvpvrtrdgeetisvdehpradttvealaklkpv
    llkqdpeatvtagnssgqndaasmcivttpekaaelglkplvrlvswgsagvapdlmgig
    pvpatevalakagltladidlielneafaaqalavmrewkfgeadhertnvrgsgislgh
    pvgatggrmlatlarelhrrearygletmcigggqglaavfervqeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5byvK (K:)
    rdavicepvrtpigryggmfrsltavdlgvtalkgllertgiaadqvedvilghcypnse
    apaigrvvaldaglpitvpgmqvdrrcgsglqaviqaclqvrsgdhdlvvaggaesmsnv
    afystdmrwggartgvqihdglargrttaggkfhpvpggmletaenlrreyhisrteqde
    lavrshqravaaqsegvlaeeiipvpvrteetisvdehpradttvealaklkpvllkqdp
    eatvtagnssgqndaasmcivttpekaaelglkplvrlvswgsagvapdlmgigpvpate
    valakagltladidlielneafaaqalavmrewkfgeadhertnvrgsgislghpvgatg
    grmlatlarelhrrearygletmcigggqglaavfervq
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5byvL (L:)
    msmrdavicepvrtpigryggmfrsltavdlgvtalkgllertgiaadqvedvilghcyp
    nseapaigrvvaldaglpitvpgmqvdrrcgsglqaviqaclqvrsgdhdlvvaggaesm
    snvafystdmrwggartgvqihdglargrttaggkfhpvpggmletaenlrreyhisrte
    qdelavrshqravaaqsegvlaeeiipvpvrtrdgeetisvdehpradttvealaklkpv
    llkqdpeatvtagnssgqndaasmcivttpekaaelglkplvrlvswgsagvapdlmgig
    pvpatevalakagltladidlielneafaaqalavmrewkfgeadhertnvrgsgislgh
    pvgatggrmlatlarelhrrearygletmcigggqglaavfervqeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5byvL (L:)
    rdavicepvrtpigryggmfrsltavdlgvtalkgllertgiaadqvedvilghcypnse
    apaigrvvaldaglpitvpgmqvdrrcgsglqaviqaclqvrsgdhdlvvaggaesmsnv
    afystdmrwggartgvqihdglargrttaggkfhpvpggmletaenlrreyhisrteqde
    lavrshqravaaqsegvlaeeiipvpvrteetisvdehpradttvealaklkpvllkqdp
    eatvtagnssgqndaasmcivttpekaaelglkplvrlvswgsagvapdlmgigpvpate
    valakagltladidlielneafaaqalavmrewkfgeadhertnvrgsgislghpvgatg
    grmlatlarelhrrearygletmcigggqglaavferv
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5byvM (M:)
    msmrdavicepvrtpigryggmfrsltavdlgvtalkgllertgiaadqvedvilghcyp
    nseapaigrvvaldaglpitvpgmqvdrrcgsglqaviqaclqvrsgdhdlvvaggaesm
    snvafystdmrwggartgvqihdglargrttaggkfhpvpggmletaenlrreyhisrte
    qdelavrshqravaaqsegvlaeeiipvpvrtrdgeetisvdehpradttvealaklkpv
    llkqdpeatvtagnssgqndaasmcivttpekaaelglkplvrlvswgsagvapdlmgig
    pvpatevalakagltladidlielneafaaqalavmrewkfgeadhertnvrgsgislgh
    pvgatggrmlatlarelhrrearygletmcigggqglaavfervqeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5byvM (M:)
    rdavicepvrtpigryggmfrsltavdlgvtalkgllertgiaadqvedvilghcypnse
    apaigrvvaldaglpitvpgmqvdrrcgsglqaviqaclqvrsgdhdlvvaggaesmsnv
    afystdmrwggartgvqihdglargrttaggkfhpvpggmletaenlrreyhisrteqde
    lavrshqravaaqsegvlaeeiipvpvretisvdehpradttvealaklkpvllkqdpea
    tvtagnssgqndaasmcivttpekaaelglkplvrlvswgsagvapdlmgigpvpateva
    lakagltladidlielneafaaqalavmrewkfgeadhertnvrgsgislghpvgatggr
    mlatlarelhrrearygletmcigggqglaavfervq