PDB entry 5bwy

View 5bwy on RCSB PDB site
Description: Structure of proplasmepsin II from Plasmodium falciparum, Space Group P43212
Class: hydrolase
Keywords: malaria, hydrolase
Deposited on 2015-06-08, released 2015-12-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-12-16, with a file datestamp of 2015-12-11.
Experiment type: XRAY
Resolution: 2.64 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Plasmepsin-2
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: PFAG_05140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5bwya_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5bwyA (A:)
    ehltigfkvenahdrilktikthklknyikesvnflnsgltktnylgssndnielvdfqn
    imfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlydssksrtyekdgtkv
    emnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastfdgilglgwkdlsi
    gsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyegpltyeklnhdlyw
    qitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvpflpfyvtlcnnsk
    lptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfilgdpfmrkyftvf
    dydnhsvgialakknl