PDB entry 5bvq

View 5bvq on RCSB PDB site
Description: Ligand-unbound pFABP4
Class: lipid binding protein
Keywords: Fatty acid-binding protein, beta-barrel protein, Gentoo penguin (Pygoscelis papua), LIPID BINDING PROTEIN
Deposited on 2015-06-05, released 2015-08-05
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-08-05, with a file datestamp of 2015-07-31.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fatty acid-binding protein
    Species: Pygoscelis papua [TaxId:30457]
    Database cross-references and differences (RAF-indexed):
    • PDB 5BVQ (0-131)
    Domains in SCOPe 2.05: d5bvqa_
  • Chain 'B':
    Compound: fatty acid-binding protein
    Species: Pygoscelis papua [TaxId:30457]
    Database cross-references and differences (RAF-indexed):
    • PDB 5BVQ (0-131)
    Domains in SCOPe 2.05: d5bvqb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5bvqA (A:)
    mcdqfvgtwkflssenfedymkelgvgfatrkmagvakpnvtisingdvitiktestfkn
    tevsfrlgeefdettaddrktknvitldngilnqvqkwdgketvikrkvmdgnlvvectm
    ntvtskrvyera
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5bvqB (B:)
    mcdqfvgtwkflssenfedymkelgvgfatrkmagvakpnvtisingdvitiktestfkn
    tevsfrlgeefdettaddrktknvitldngilnqvqkwdgketvikrkvmdgnlvvectm
    ntvtskrvyera