PDB entry 5bv5

View 5bv5 on RCSB PDB site
Description: Structure of CYP119 with T213A and C317H mutations
Class: oxidoreductase
Keywords: P450, heme, P420, cytochrome, OXIDOREDUCTASE
Deposited on 2015-06-04, released 2016-02-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450 119
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed):
    • PDB 5BV5 (0-End)
    Domains in SCOPe 2.07: d5bv5a_
  • Chain 'B':
    Compound: cytochrome p450 119
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed):
    • PDB 5BV5 (0-End)
  • Chain 'C':
    Compound: cytochrome p450 119
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed):
    • PDB 5BV5 (0-End)
    Domains in SCOPe 2.07: d5bv5c_
  • Chain 'D':
    Compound: cytochrome p450 119
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed):
    • PDB 5BV5 (0-End)
    Domains in SCOPe 2.07: d5bv5d_
  • Heterogens: PO4, HEM, PIM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5bv5A (A:)
    mydwfsemrkkdpvyydgniwqvfsyrytkevlnnfskfssdltgyherledlrngkirf
    diptrytmltsdpplhdelrsmsadifspqklqtletfirettrslldsidpreddivkk
    lavplpiiviskilglpiedkekfkewsdlvafrlgkpgeifelgkkyleligyvkdhln
    sgtevvsrvvnsnlsdieklgyiillliagneattnlisnsvidftrfnlwqrireenly
    lkaieealrysppvmrtvrktkervklgdqtieegeyvrvwiasanrdeevfhdgekfip
    drnpnphlsfgsgihlhlgaplarleariaieefskrfrhieildtekvpnevlngykrl
    vvrlksne
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bv5A (A:)
    mydwfsemrkkdpvyydgniwqvfsyrytkevlnnfskfssdlpplhdelrsmsadifsp
    qklqtletfirettrslldsidpreddivkklavplpiiviskilglpiedkekfkewsi
    felgkkyleligyvkdhlsgtevvsrlsdieklgyiillliagneattnlisnsvidftr
    fnlwqrireenlylkaieealrysppvmrtvrktkervklgdqtieegeyvrvwiasanr
    deevfhdgekfipdrnpnphlsfgslhlgaplarleariaieefskrfrhieildtekvp
    nevlngykrlvvrlk
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5bv5C (C:)
    mydwfsemrkkdpvyydgniwqvfsyrytkevlnnfskfssdltgyherledlrngkirf
    diptrytmltsdpplhdelrsmsadifspqklqtletfirettrslldsidpreddivkk
    lavplpiiviskilglpiedkekfkewsdlvafrlgkpgeifelgkkyleligyvkdhln
    sgtevvsrvvnsnlsdieklgyiillliagneattnlisnsvidftrfnlwqrireenly
    lkaieealrysppvmrtvrktkervklgdqtieegeyvrvwiasanrdeevfhdgekfip
    drnpnphlsfgsgihlhlgaplarleariaieefskrfrhieildtekvpnevlngykrl
    vvrlksne
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bv5C (C:)
    mydwfsemrkkdpvyydgniwqvfsyrytkevlnnfskfssdlplhdelrsmsadifspq
    klqtletfirettrslldsidpreddivkklavplpiiviskilglpgeifelgkkylel
    igyvkdhlnsgtevvsrvvnlsdieklgyiillliagneattnlisnsvidftrfnlwqr
    ireenlylkaieealrysppvmrtvrktkervklgdqtieegeyvrvwiasanrdeevfh
    dgekfipdrnpnphlsfgsgihlhlgaplarleariaieefskrfrhieildtekvpnev
    lngykrlvvrl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5bv5D (D:)
    mydwfsemrkkdpvyydgniwqvfsyrytkevlnnfskfssdltgyherledlrngkirf
    diptrytmltsdpplhdelrsmsadifspqklqtletfirettrslldsidpreddivkk
    lavplpiiviskilglpiedkekfkewsdlvafrlgkpgeifelgkkyleligyvkdhln
    sgtevvsrvvnsnlsdieklgyiillliagneattnlisnsvidftrfnlwqrireenly
    lkaieealrysppvmrtvrktkervklgdqtieegeyvrvwiasanrdeevfhdgekfip
    drnpnphlsfgsgihlhlgaplarleariaieefskrfrhieildtekvpnevlngykrl
    vvrlksne
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bv5D (D:)
    mydwfsemrkkdpvyydgniwqvfsyrytkevlnnfskfssdpplhdelrsmsadifspq
    klqtletfirettrslldsidpreddivkklavplpiiviskilglpiedkekfkewsdl
    vafifelgkkyleligyvkdhlnsgtevvsrvvsnlsdieklgyiillliagneattnli
    snsvidftrfnlwqrireenlylkaieealrysppvmrtvrktkervkldqtieegeyvr
    vwiasanrdeevfhdgekfipdrnpnphlsfgsgihlhlgaplarleariaieefskrfr
    hieildtekvpnevlngykrlvvrlks