PDB entry 5buv

View 5buv on RCSB PDB site
Description: X-ray structure of WbcA from Yersinia enterocolitica
Class: isomerase
Keywords: lipopolysaccharide, ISOMERASE
Deposited on 2015-06-04, released 2015-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative epimerase
    Species: Yersinia enterocolitica subsp. enterocolitica 8081 [TaxId:393305]
    Gene: wbcA, YE3085
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1JNA0 (5-End)
      • expression tag (3-4)
    Domains in SCOPe 2.07: d5buva1, d5buva2
  • Chain 'B':
    Compound: Putative epimerase
    Species: Yersinia enterocolitica subsp. enterocolitica 8081 [TaxId:393305]
    Gene: wbcA, YE3085
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1JNA0 (5-End)
      • expression tag (4)
    Domains in SCOPe 2.07: d5buvb1, d5buvb2
  • Chain 'C':
    Compound: Putative epimerase
    Species: Yersinia enterocolitica subsp. enterocolitica 8081 [TaxId:393305]
    Gene: wbcA, YE3085
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1JNA0 (5-End)
      • expression tag (1-4)
    Domains in SCOPe 2.07: d5buvc1, d5buvc2
  • Heterogens: PO4, CYT, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5buvA (A:)
    ghmasiinitelnisgcyliespifsdergefvkthhqeifknfgleipsaeeyysrskn
    nvirgmhfqqypddhnklvfcpegevldvfldirkdsntygqfmsfilnphnrrsiflak
    giahgflsmkdntlivcktstvhspsrdsgihwnsfgfkwpvenpiisdkdrnldcff
    

    Sequence, based on observed residues (ATOM records): (download)
    >5buvA (A:)
    asiinitelnisgcyliespifsdergefvkthhqeifknfgleipsaeeyysrsknnvi
    rgmhfqqypddhnklvfcpegevldvfldirkdsntygqfmsfilnphnrrsiflakgia
    hgflsmkdntlivcktstvhspsrdsgihwnsfgfkwpvenpiisdkdrnldcf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5buvB (B:)
    ghmasiinitelnisgcyliespifsdergefvkthhqeifknfgleipsaeeyysrskn
    nvirgmhfqqypddhnklvfcpegevldvfldirkdsntygqfmsfilnphnrrsiflak
    giahgflsmkdntlivcktstvhspsrdsgihwnsfgfkwpvenpiisdkdrnldcff
    

    Sequence, based on observed residues (ATOM records): (download)
    >5buvB (B:)
    siinitelnisgcyliespifsdergefvkthhqeifknfgleipsaeeyysrsknnvir
    gmhfqqypddhnklvfcpegevldvfldirkdsntygqfmsfilnphnrrsiflakgiah
    gflsmkdntlivcktstvhspsrdsgihwnsfgfkwpvenpiisdkdrnldcf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5buvC (C:)
    ghmasiinitelnisgcyliespifsdergefvkthhqeifknfgleipsaeeyysrskn
    nvirgmhfqqypddhnklvfcpegevldvfldirkdsntygqfmsfilnphnrrsiflak
    giahgflsmkdntlivcktstvhspsrdsgihwnsfgfkwpvenpiisdkdrnldcff
    

    Sequence, based on observed residues (ATOM records): (download)
    >5buvC (C:)
    hmasiinitelnisgcyliespifsdergefvkthhqeifknfgleipsaeeyysrsknn
    virgmhfqqypddhnklvfcpegevldvfldirkdsntygqfmsfilnphnrrsiflakg
    iahgflsmkdntlivcktstvhspsrdsgihwnsfgfkwpvenpiisdkdrnldcf