PDB entry 5bu7

View 5bu7 on RCSB PDB site
Description: Crystal structure of an engineered protein that forms nanotubes with tunable diameters
Class: metal binding protein
Keywords: Metalloprotein, Hemeprotein, METAL BINDING PROTEIN
Deposited on 2015-06-03, released 2016-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.46 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (26-27)
      • engineered mutation (30)
      • engineered mutation (33)
      • engineered mutation (37)
      • engineered mutation (40)
      • engineered mutation (58)
      • engineered mutation (65)
      • engineered mutation (68)
      • engineered mutation (72)
      • engineered mutation (75-76)
      • engineered mutation (95)
      • engineered mutation (97)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d5bu7a_
  • Chain 'B':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (26-27)
      • engineered mutation (30)
      • engineered mutation (33)
      • engineered mutation (37)
      • engineered mutation (40)
      • engineered mutation (58)
      • engineered mutation (65)
      • engineered mutation (68)
      • engineered mutation (72)
      • engineered mutation (75-76)
      • engineered mutation (95)
      • engineered mutation (97)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d5bu7b_
  • Heterogens: HEM, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5bu7A (A:)
    adlednmetlndnlkviekadnaaqvekalekmlaaaadalkatppkledkspdspemhd
    frhgfailmgqihdaahlanegkvkeaqaaaeqlkctcnachqkyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5bu7B (B:)
    adlednmetlndnlkviekadnaaqvekalekmlaaaadalkatppkledkspdspemhd
    frhgfailmgqihdaahlanegkvkeaqaaaeqlkctcnachqkyr