PDB entry 5btq

View 5btq on RCSB PDB site
Description: Crystal structure of human heme oxygenase 1 H25R with biliverdin bound
Class: oxidoreductase
Keywords: Heme oxygenase, Proximal histidine, Heme coordination, Site-directed mutagenesis, Biliverdin biosensor, OXIDOREDUCTASE
Deposited on 2015-06-03, released 2016-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-14, with a file datestamp of 2016-09-09.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heme oxygenase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HMOX1, HO, HO1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09601
      • engineered mutation (28)
    Domains in SCOPe 2.07: d5btqa_
  • Chain 'B':
    Compound: Heme oxygenase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HMOX1, HO, HO1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09601
      • engineered mutation (28)
    Domains in SCOPe 2.07: d5btqb_
  • Heterogens: BLA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5btqA (A:)
    gshmmerpqpdsmpqdlsealkeatkevrtqaenaefmrnfqkgqvtrdgfklvmaslyh
    iyvaleeeiernkespvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvk
    rlhevgrtepellvahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasat
    kfkqlyrsrmnslemtpavrqrvieeaktafllniqlfeelqellthdtkdqspsra
    

    Sequence, based on observed residues (ATOM records): (download)
    >5btqA (A:)
    qdlsealkeatkevrtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernke
    spvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepellv
    ahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsle
    mtpavrqrvieeaktafllniqlfeelqellth
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5btqB (B:)
    gshmmerpqpdsmpqdlsealkeatkevrtqaenaefmrnfqkgqvtrdgfklvmaslyh
    iyvaleeeiernkespvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvk
    rlhevgrtepellvahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasat
    kfkqlyrsrmnslemtpavrqrvieeaktafllniqlfeelqellthdtkdqspsra
    

    Sequence, based on observed residues (ATOM records): (download)
    >5btqB (B:)
    pqdlsealkeatkevrtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
    espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
    vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
    emtpavrqrvieeaktafllniqlfeelqellthd