PDB entry 5bt9

View 5bt9 on RCSB PDB site
Description: Crystal Structure of FolM Alternative dihydrofolate reductase 1 from Brucella canis complexed with NADP
Class: oxidoreductase
Keywords: SSGCID, FolM, Alternative dihydrofolate reductase 1, fabG, oxidoreductase, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease
Deposited on 2015-06-02, released 2015-07-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-07-29, with a file datestamp of 2015-07-24.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein BrcaA.00010.a
    Species: Brucella ovis IntaBari-2002-82-58 [TaxId:1293916]
    Gene: H715_00685
    Database cross-references and differences (RAF-indexed):
    • Uniprot N8M0H2
      • conflict (139)
    Domains in SCOPe 2.05: d5bt9a_
  • Chain 'B':
    Compound: Uncharacterized protein BrcaA.00010.a
    Species: Brucella ovis IntaBari-2002-82-58 [TaxId:1293916]
    Gene: H715_00685
    Database cross-references and differences (RAF-indexed):
    • Uniprot N8M0H2 (Start-263)
      • conflict (139)
      • expression tag (264)
    Domains in SCOPe 2.05: d5bt9b_
  • Chain 'C':
    Compound: Uncharacterized protein BrcaA.00010.a
    Species: Brucella ovis IntaBari-2002-82-58 [TaxId:1293916]
    Gene: H715_00685
    Database cross-references and differences (RAF-indexed):
    • Uniprot N8M0H2 (Start-263)
      • conflict (139)
    Domains in SCOPe 2.05: d5bt9c_
  • Chain 'D':
    Compound: Uncharacterized protein BrcaA.00010.a
    Species: Brucella ovis IntaBari-2002-82-58 [TaxId:1293916]
    Gene: H715_00685
    Database cross-references and differences (RAF-indexed):
    • Uniprot N8M0H2 (Start-263)
      • conflict (139)
      • expression tag (264)
    Domains in SCOPe 2.05: d5bt9d_
  • Heterogens: NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5bt9A (A:)
    mahhhhhhmvlndpearmvancpvlvtggarrigkaivedlashgfpvaihcnrsldege
    aianrindsggnacvvqadlegdvrglvkqasdrigpirllvnnaslfqedkvgaldmal
    wdrhfavhlktpvilaedmrkalpedqdglvvniidqrvwklnpqffsytlsktalwnat
    rtlaqalaprirvnaiapgptlpserqrpedferqvsklplqrapelpefgrtvryfwen
    rsitgqmialdggqhlawetpdiaelpnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bt9A (A:)
    earmvancpvlvtggarrigkaivedlashgfpvaihcnrsldegeaianrindsggnac
    vvqadlegdvrglvkqasdrigpirllvnnaslfqedkvgaldmalwdrhfavhlktpvi
    laedmrkalpedqdglvvniidqrvwklnpqffsytlsktalwnatrtlaqalaprirvn
    aiapgptlpserqrpedferqvsklplqrapelpefgrtvryfwenrsitgqmialdggq
    hlawetpdi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5bt9B (B:)
    mahhhhhhmvlndpearmvancpvlvtggarrigkaivedlashgfpvaihcnrsldege
    aianrindsggnacvvqadlegdvrglvkqasdrigpirllvnnaslfqedkvgaldmal
    wdrhfavhlktpvilaedmrkalpedqdglvvniidqrvwklnpqffsytlsktalwnat
    rtlaqalaprirvnaiapgptlpserqrpedferqvsklplqrapelpefgrtvryfwen
    rsitgqmialdggqhlawetpdiaelpnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bt9B (B:)
    armvancpvlvtggarrigkaivedlashgfpvaihcnrsldegeaianrindsggnacv
    vqadlegdvrglvkqasdrigpirllvnnaslfqedkvgaldmalwdrhfavhlktpvil
    aedmrkalpedqdglvvniidqrvwklnpqffsytlsktalwnatrtlaqalaprirvna
    iapgptlpsrpedferqvsklplqrapelpefgrtvryfwenrsitgqmialdggqhlaw
    etpdiae
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5bt9C (C:)
    mahhhhhhmvlndpearmvancpvlvtggarrigkaivedlashgfpvaihcnrsldege
    aianrindsggnacvvqadlegdvrglvkqasdrigpirllvnnaslfqedkvgaldmal
    wdrhfavhlktpvilaedmrkalpedqdglvvniidqrvwklnpqffsytlsktalwnat
    rtlaqalaprirvnaiapgptlpserqrpedferqvsklplqrapelpefgrtvryfwen
    rsitgqmialdggqhlawetpdiaelpnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bt9C (C:)
    earmvancpvlvtggarrigkaivedlashgfpvaihcnrsldegeaianrindsggnac
    vvqadlegdvrglvkqasdrigpirllvnnaslfqedkvgaldmalwdrhfavhlktpvi
    laedmrkalpedqdglvvniidqrvwklnpqffsytlsktalwnatrtlaqalaprirvn
    aiapgptlpserqrpedferqvsklplqrapelpefgrtvryfwenrsitgqmialdggq
    hlawetpdia
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5bt9D (D:)
    mahhhhhhmvlndpearmvancpvlvtggarrigkaivedlashgfpvaihcnrsldege
    aianrindsggnacvvqadlegdvrglvkqasdrigpirllvnnaslfqedkvgaldmal
    wdrhfavhlktpvilaedmrkalpedqdglvvniidqrvwklnpqffsytlsktalwnat
    rtlaqalaprirvnaiapgptlpserqrpedferqvsklplqrapelpefgrtvryfwen
    rsitgqmialdggqhlawetpdiaelpnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bt9D (D:)
    rmvancpvlvtggarrigkaivedlashgfpvaihcnrsldegeaianrindsggnacvv
    qadlegdvrglvkqasdrigpirllvnnaslfqedkvgaldmalwdrhfavhlktpvila
    edmrkalpedqdglvvniidqrvwklnpqffsytlsktalwnatrtlaqalaprirvnai
    apgptlppedferqvsklplqrapelpefgrtvryfwenrsitgqmialdggqhlawetp
    diae