PDB entry 5bt8

View 5bt8 on RCSB PDB site
Description: X-ray Crystal Structure of phosphoglycerate kinase from Acinetobacter baumannii
Class: transferase
Keywords: phosphoglycerate kinase, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, TRANSFERASE
Deposited on 2015-06-02, released 2015-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoglycerate kinase
    Species: Acinetobacter baumannii [TaxId:1116234]
    Gene: pgk, A591_A2233
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5bt8a1, d5bt8a2
  • Chain 'B':
    Compound: phosphoglycerate kinase
    Species: Acinetobacter baumannii [TaxId:1116234]
    Gene: pgk, A591_A2233
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5bt8b1, d5bt8b2
  • Chain 'C':
    Compound: phosphoglycerate kinase
    Species: Acinetobacter baumannii [TaxId:1116234]
    Gene: pgk, A591_A2233
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5bt8c1, d5bt8c2
  • Chain 'D':
    Compound: phosphoglycerate kinase
    Species: Acinetobacter baumannii [TaxId:1116234]
    Gene: pgk, A591_A2233
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5bt8d_
  • Chain 'E':
    Compound: phosphoglycerate kinase
    Species: Acinetobacter baumannii [TaxId:1116234]
    Gene: pgk, A591_A2233
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5bt8e_
  • Chain 'F':
    Compound: phosphoglycerate kinase
    Species: Acinetobacter baumannii [TaxId:1116234]
    Gene: pgk, A591_A2233
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5bt8f1, d5bt8f2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5bt8A (A:)
    mahhhhhhmnfqrmtdlnlagkrvliredlnvpvkngvitsdarlraalptikaalekga
    avmvfshlgrpvegepkpeqslapvaayltealgqevklftdyldgveveagqvvllenv
    rfnpgekknnpelaqkyaalcdvfvmdafgtahraeastegvarfapvaaagpllaaeld
    algramqtpekpmvaivagskvstkldvlnslsgicdqlivgggiantflaaagynvgks
    lyeadlvetakqiaakvsvplptdvvvadasqinfedflgslaaaqavikkvedvtandm
    ildvgpetakafanilttsktilwngpvgvfevdqfgegtkalslavaqsdafsiagggd
    tlaaidkynvadqigyistgggaflefvegktlpavavllera
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bt8A (A:)
    hmnfqrmtdlnlagkrvliredlnvpvkngvitsdarlraalptikaalekgaavmvfsh
    lgrpvegepkpeqslapvaayltealgqevklftdyldgveveagqvvllenvrfnpgek
    knnpelaqkyaalcdvfvmdafgtahraeastegvarfapvaaagpllaaeldalgramq
    tpekpmvaivagskvstkldvlnslsgicdqlivgggiantflaaagynvgkslyeadlv
    etakqiaakvsvplptdvvvadasqinfedflgslaaaqavikkvedvtandmildvgpe
    takafanilttsktilwngpvgvfevdqfgegtkalslavaqsdafsiagggdtlaaidk
    ynvadqigyistgggaflefvegktlpavavllera
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5bt8B (B:)
    mahhhhhhmnfqrmtdlnlagkrvliredlnvpvkngvitsdarlraalptikaalekga
    avmvfshlgrpvegepkpeqslapvaayltealgqevklftdyldgveveagqvvllenv
    rfnpgekknnpelaqkyaalcdvfvmdafgtahraeastegvarfapvaaagpllaaeld
    algramqtpekpmvaivagskvstkldvlnslsgicdqlivgggiantflaaagynvgks
    lyeadlvetakqiaakvsvplptdvvvadasqinfedflgslaaaqavikkvedvtandm
    ildvgpetakafanilttsktilwngpvgvfevdqfgegtkalslavaqsdafsiagggd
    tlaaidkynvadqigyistgggaflefvegktlpavavllera
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bt8B (B:)
    hhmnfqrmtdlnlagkrvliredlnvpvkngvitsdarlraalptikaalekgaavmvfs
    hlgrpvegepkpeqslapvaayltealgqevklftdyldgveveagqvvllenvrfnpge
    kknnpelaqkyaalcdvfvmdafgtahraeastegvarfapvaaagpllaaeldalgram
    qtpekpmvaivagskvstkldvlnslsgicdqlivgggiantflaaagynvgkslyeadl
    vetakqiaakvsvplptdvvvadasqinfedflgslaaaqavikkvedvtandmildvgp
    etakafanilttsktilwngpvgvfevdqfgegtkalslavaqsdafsiagggdtlaaid
    kynvadqigyistgggaflefvegktlpavavllera
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5bt8C (C:)
    mahhhhhhmnfqrmtdlnlagkrvliredlnvpvkngvitsdarlraalptikaalekga
    avmvfshlgrpvegepkpeqslapvaayltealgqevklftdyldgveveagqvvllenv
    rfnpgekknnpelaqkyaalcdvfvmdafgtahraeastegvarfapvaaagpllaaeld
    algramqtpekpmvaivagskvstkldvlnslsgicdqlivgggiantflaaagynvgks
    lyeadlvetakqiaakvsvplptdvvvadasqinfedflgslaaaqavikkvedvtandm
    ildvgpetakafanilttsktilwngpvgvfevdqfgegtkalslavaqsdafsiagggd
    tlaaidkynvadqigyistgggaflefvegktlpavavllera
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bt8C (C:)
    hmnfqrmtdlnlagkrvliredlnvpvkngvitsdarlraalptikaalekgaavmvfsh
    lgrpvegepkpeqslapvaayltealgqevklftdyldgveveagqvvllenvrfnpgek
    knnpelaqkyaalcdvfvmdafgtahraeastegvarfapvaaagpllaaeldalgramq
    tpekpmvaivagskvstkldvlnslsgicdqlivgggiantflaaagynvgkslyeadlv
    etakqiaakvsvplptdvvvadasqinfedflgslaaaqavikkvedvtandmildvgpe
    takafanilttsktilwngpvgvfevdqfgegtkalslavaqsdafsiagggdtlaaidk
    ynvadqigyistgggaflefvegktlpavavllera
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5bt8D (D:)
    mahhhhhhmnfqrmtdlnlagkrvliredlnvpvkngvitsdarlraalptikaalekga
    avmvfshlgrpvegepkpeqslapvaayltealgqevklftdyldgveveagqvvllenv
    rfnpgekknnpelaqkyaalcdvfvmdafgtahraeastegvarfapvaaagpllaaeld
    algramqtpekpmvaivagskvstkldvlnslsgicdqlivgggiantflaaagynvgks
    lyeadlvetakqiaakvsvplptdvvvadasqinfedflgslaaaqavikkvedvtandm
    ildvgpetakafanilttsktilwngpvgvfevdqfgegtkalslavaqsdafsiagggd
    tlaaidkynvadqigyistgggaflefvegktlpavavllera
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bt8D (D:)
    mnfqrmtdlnlagkrvliredlnvpvkngvitsdarlraalptikaalekgaavmvfshl
    grpvegepkpeqslapvaayltealgqevklftdyldgveveagqvvllenvrfnpgekk
    nnpelaqkyaalcdvfvmdafgtahraeastegvarfapvaaagpllaaeldalgramqt
    pekpmvaivagskvstkldvlnslsgicdqlivgggiantflaaagynvgkslyeadlve
    takqiaakvsvplptdvvvadasqinfedflgslaaaqavikkvedvtandmildvgpet
    akafanilttsktilwngpvgvfevdqfgegtkalslavaqsdafsiagggdtlaaidky
    nvadqigyistgggaflefvegktlpavavllera
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5bt8E (E:)
    mahhhhhhmnfqrmtdlnlagkrvliredlnvpvkngvitsdarlraalptikaalekga
    avmvfshlgrpvegepkpeqslapvaayltealgqevklftdyldgveveagqvvllenv
    rfnpgekknnpelaqkyaalcdvfvmdafgtahraeastegvarfapvaaagpllaaeld
    algramqtpekpmvaivagskvstkldvlnslsgicdqlivgggiantflaaagynvgks
    lyeadlvetakqiaakvsvplptdvvvadasqinfedflgslaaaqavikkvedvtandm
    ildvgpetakafanilttsktilwngpvgvfevdqfgegtkalslavaqsdafsiagggd
    tlaaidkynvadqigyistgggaflefvegktlpavavllera
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bt8E (E:)
    mnfqrmtdlnlagkrvliredlnvpvkngvitsdarlraalptikaalekgaavmvfshl
    grpvegepkpeqslapvaayltealgqevklftdyldgveveagqvvllenvrfnpgekk
    nnpelaqkyaalcdvfvmdafgtahraeastegvarfapvaaagpllaaeldalgramqt
    pekpmvaivagskvstkldvlnslsgicdqlivgggiantflaaagynvgkslyeadlve
    takqiaakvsvplptdvvvadasqinfedflgslaaaqavikkvedvtandmildvgpet
    akafanilttsktilwngpvgvfevdqfgegtkalslavaqsdafsiagggdtlaaidky
    nvadqigyistgggaflefvegktlpavavllera
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5bt8F (F:)
    mahhhhhhmnfqrmtdlnlagkrvliredlnvpvkngvitsdarlraalptikaalekga
    avmvfshlgrpvegepkpeqslapvaayltealgqevklftdyldgveveagqvvllenv
    rfnpgekknnpelaqkyaalcdvfvmdafgtahraeastegvarfapvaaagpllaaeld
    algramqtpekpmvaivagskvstkldvlnslsgicdqlivgggiantflaaagynvgks
    lyeadlvetakqiaakvsvplptdvvvadasqinfedflgslaaaqavikkvedvtandm
    ildvgpetakafanilttsktilwngpvgvfevdqfgegtkalslavaqsdafsiagggd
    tlaaidkynvadqigyistgggaflefvegktlpavavllera
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bt8F (F:)
    hhmnfqrmtdlnlagkrvliredlnvpvkngvitsdarlraalptikaalekgaavmvfs
    hlgrpvegepkpeqslapvaayltealgqevklftdyldgveveagqvvllenvrfnpge
    kknnpelaqkyaalcdvfvmdafgtahraeastegvarfapvaaagpllaaeldalgram
    qtpekpmvaivagskvstkldvlnslsgicdqlivgggiantflaaagynvgkslyeadl
    vetakqiaakvsvplptdvvvadasqinfedflgslaaaqavikkvedvtandmildvgp
    etakafanilttsktilwngpvgvfevdqfgegtkalslavaqsdafsiagggdtlaaid
    kynvadqigyistgggaflefvegktlpavavllera