PDB entry 5bt1

View 5bt1 on RCSB PDB site
Description: histone chaperone Hif1 playing with histone H2A-H2B dimer
Class: chaperone
Keywords: Histone chaperone complex, TPR, NASP homolog, assembly, CHAPERONE
Deposited on 2015-06-02, released 2016-10-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-10-26, with a file datestamp of 2016-10-21.
Experiment type: XRAY
Resolution: 2.62 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: HAT1-interacting factor 1
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Gene: HIF1, YLL022C, L1205
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q12373
• Chain 'B':
  Compound: HAT1-interacting factor 1
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Gene: HIF1, YLL022C, L1205
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q12373
• Chain 'C':
  Compound: histone h2a.1
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Gene: HTA1, H2A1, SPT11, YDR225W, YD9934.10
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04911
  Domains in SCOPe 2.06: d5bt1c_
• Chain 'D':
  Compound: Histone H2B.1
  Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
  Gene: HTB1, H2B1, SPT12, YDR224C, YD9934.09C
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02293
  Domains in SCOPe 2.06: d5bt1d_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >5bt1C (C:)
  mghhhhhhgshmsggkggkagsaakasqsrsakagltfpvgrvhrllrrgnyaqrigsga
  pvyltavleylaaeilelagnaardnkktriiprhlqlairnddelnkllgnvtiaqggv
  lpnihqnllpkksakatkasqel
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >5bt1C (C:)
  qsrsakagltfpvgrvhrllrrgnyaqrigsgapvyltavleylaaeilelagnaardnk
  ktriiprhlqlairnddelnkllgn
  

  
  
• Chain 'D':
  Sequence, based on SEQRES records: (download)
  

  >5bt1D (D:)
  mghhhhhhgshmsakaekkpaskapaekkpaakktststdgkkrskarketyssyiykvl
  kqthpdtgisqksmsilnsfvndiferiateasklaaynkkstisareiqtavrlilpge
  lakhavsegtravtkyssstqa
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >5bt1D (D:)
  ketyssyiykvlkqthpdtgisqksmsilnsfvndiferiateasklaaynkkstisare
  iqtavrlilpgelakhavsegtravtkyss