PDB entry 5bsh

View 5bsh on RCSB PDB site
Description: Crystal structure of Medicago truncatula (delta)1-Pyrroline-5-Carboxylate Reductase (MtP5CR) in complex with L-Proline
Class: oxidoreductase
Keywords: proline biosynthesis, decamer, P5C, plant protein, OXIDOREDUCTASE
Deposited on 2015-06-02, released 2015-11-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-11-11, with a file datestamp of 2015-11-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyrroline-5-carboxylate reductase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_7g090160
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5bsha1, d5bsha2
  • Chain 'B':
    Compound: pyrroline-5-carboxylate reductase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_7g090160
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5bshb1, d5bshb2
  • Chain 'C':
    Compound: pyrroline-5-carboxylate reductase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_7g090160
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5bshc1, d5bshc2
  • Chain 'D':
    Compound: pyrroline-5-carboxylate reductase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_7g090160
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5bshd1, d5bshd2
  • Chain 'E':
    Compound: pyrroline-5-carboxylate reductase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_7g090160
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5bshe1, d5bshe2
  • Chain 'F':
    Compound: pyrroline-5-carboxylate reductase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_7g090160
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5bshf1, d5bshf2
  • Chain 'G':
    Compound: pyrroline-5-carboxylate reductase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_7g090160
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5bshg1, d5bshg2
  • Chain 'H':
    Compound: pyrroline-5-carboxylate reductase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_7g090160
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5bshh1, d5bshh2
  • Chain 'I':
    Compound: pyrroline-5-carboxylate reductase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_7g090160
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5bshi1, d5bshi2
  • Chain 'J':
    Compound: pyrroline-5-carboxylate reductase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_7g090160
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5bshj1, d5bshj2
  • Heterogens: PRO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5bshA (A:)
    snameiipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesi
    gitvlssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewa
    gherfirvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitg
    lsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvt
    spggttiagvhelekagfrgilmnavvaaakrsqels
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bshA (A:)
    iipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvl
    ssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherf
    irvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitglsgsg
    payiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvtspggt
    tiagvhelekagfrgilmnavvaaakrsqels
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5bshB (B:)
    snameiipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesi
    gitvlssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewa
    gherfirvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitg
    lsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvt
    spggttiagvhelekagfrgilmnavvaaakrsqels
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bshB (B:)
    iipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvl
    ssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherf
    irvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitglsgsg
    payiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvtspggt
    tiagvhelekagfrgilmnavvaaakrsqels
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5bshC (C:)
    snameiipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesi
    gitvlssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewa
    gherfirvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitg
    lsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvt
    spggttiagvhelekagfrgilmnavvaaakrsqels
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bshC (C:)
    pipadsytlgfigagkmaesiakgavrsgvlspsriktasnparrtafesigitvlssnd
    dvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherfirvm
    pntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitglsgsgpayi
    ylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvtspggttiag
    vhelekagfrgilmnavvaaakrsqels
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5bshD (D:)
    snameiipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesi
    gitvlssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewa
    gherfirvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitg
    lsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvt
    spggttiagvhelekagfrgilmnavvaaakrsqels
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bshD (D:)
    pipadsytlgfigagkmaesiakgavrsgvlspsriktasnparrtafesigitvlssnd
    dvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherfirvm
    pntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitglsgsgpayi
    ylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvtspggttiag
    vhelekagfrgilmnavvaaakrsqels
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5bshE (E:)
    snameiipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesi
    gitvlssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewa
    gherfirvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitg
    lsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvt
    spggttiagvhelekagfrgilmnavvaaakrsqels
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bshE (E:)
    iipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvl
    ssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherf
    irvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitglsgsg
    payiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvtspggt
    tiagvhelekagfrgilmnavvaaakrsqels
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5bshF (F:)
    snameiipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesi
    gitvlssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewa
    gherfirvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitg
    lsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvt
    spggttiagvhelekagfrgilmnavvaaakrsqels
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bshF (F:)
    iipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvl
    ssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherf
    irvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitglsgsg
    payiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvtspggt
    tiagvhelekagfrgilmnavvaaakrsqels
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5bshG (G:)
    snameiipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesi
    gitvlssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewa
    gherfirvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitg
    lsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvt
    spggttiagvhelekagfrgilmnavvaaakrsqels
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bshG (G:)
    padsytlgfigagkmaesiakgavrsgvlspsriktaarrtafesigitvlssnddvvrd
    snvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherfirvmpntaa
    tvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitglsgsgpayiylaie
    aladggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvtspggttiagvhele
    kagfrgilmnavvaaakrsqels
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5bshH (H:)
    snameiipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesi
    gitvlssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewa
    gherfirvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitg
    lsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvt
    spggttiagvhelekagfrgilmnavvaaakrsqels
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bshH (H:)
    iipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvl
    ssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherf
    irvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitglsgsg
    payiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvtspggt
    tiagvhelekagfrgilmnavvaaakrsqels
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5bshI (I:)
    snameiipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesi
    gitvlssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewa
    gherfirvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitg
    lsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvt
    spggttiagvhelekagfrgilmnavvaaakrsqels
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bshI (I:)
    pipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvlss
    nddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherfir
    vmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitglsgsgpa
    yiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvtspggtti
    agvhelekagfrgilmnavvaaakrsqels
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5bshJ (J:)
    snameiipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesi
    gitvlssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewa
    gherfirvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitg
    lsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvt
    spggttiagvhelekagfrgilmnavvaaakrsqels
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bshJ (J:)
    ipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvls
    snddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherfi
    rvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitglsgsgp
    ayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvtspggtt
    iagvhelekagfrgilmnavvaaakrsqels