PDB entry 5bsg

View 5bsg on RCSB PDB site
Description: Crystal structure of Medicago truncatula (delta)1-Pyrroline-5-Carboxylate Reductase (MtP5CR) in complex with NADP+
Class: oxidoreductase
Keywords: proline biosynthesis, decamer, P5C, plant protein, OXIDOREDUCTASE
Deposited on 2015-06-02, released 2015-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-12-02, with a file datestamp of 2015-11-27.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyrroline-5-carboxylate reductase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_7g090160
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5bsga1, d5bsga2
  • Chain 'B':
    Compound: pyrroline-5-carboxylate reductase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_7g090160
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5bsgb1, d5bsgb2
  • Chain 'C':
    Compound: pyrroline-5-carboxylate reductase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_7g090160
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5bsgc1, d5bsgc2
  • Chain 'D':
    Compound: pyrroline-5-carboxylate reductase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_7g090160
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5bsgd1, d5bsgd2
  • Chain 'E':
    Compound: pyrroline-5-carboxylate reductase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_7g090160
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5bsge1, d5bsge2
  • Chain 'F':
    Compound: pyrroline-5-carboxylate reductase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_7g090160
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5bsgf1, d5bsgf2
  • Chain 'G':
    Compound: pyrroline-5-carboxylate reductase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_7g090160
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5bsgg1, d5bsgg2
  • Chain 'H':
    Compound: pyrroline-5-carboxylate reductase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_7g090160
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5bsgh1, d5bsgh2
  • Chain 'I':
    Compound: pyrroline-5-carboxylate reductase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_7g090160
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5bsgi1, d5bsgi2
  • Chain 'J':
    Compound: pyrroline-5-carboxylate reductase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_7g090160
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5bsgj1, d5bsgj2
  • Heterogens: NAP, MPO, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5bsgA (A:)
    snameiipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesi
    gitvlssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewa
    gherfirvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitg
    lsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvt
    spggttiagvhelekagfrgilmnavvaaakrsqels
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bsgA (A:)
    iipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvl
    ssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherf
    irvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitglsgsg
    payiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvtspggt
    tiagvhelekagfrgilmnavvaaakrsqels
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5bsgB (B:)
    snameiipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesi
    gitvlssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewa
    gherfirvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitg
    lsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvt
    spggttiagvhelekagfrgilmnavvaaakrsqels
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bsgB (B:)
    iipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvl
    ssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherf
    irvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitglsgsg
    payiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvtspggt
    tiagvhelekagfrgilmnavvaaakrsqels
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5bsgC (C:)
    snameiipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesi
    gitvlssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewa
    gherfirvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitg
    lsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvt
    spggttiagvhelekagfrgilmnavvaaakrsqels
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bsgC (C:)
    pipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvlss
    nddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherfir
    vmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitglsgsgpa
    yiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvtspggtti
    agvhelekagfrgilmnavvaaakrsqels
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5bsgD (D:)
    snameiipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesi
    gitvlssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewa
    gherfirvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitg
    lsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvt
    spggttiagvhelekagfrgilmnavvaaakrsqels
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bsgD (D:)
    ipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvls
    snddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherfi
    rvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitglsgsgp
    ayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvtspggtt
    iagvhelekagfrgilmnavvaaakrsqels
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5bsgE (E:)
    snameiipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesi
    gitvlssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewa
    gherfirvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitg
    lsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvt
    spggttiagvhelekagfrgilmnavvaaakrsqels
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bsgE (E:)
    iipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvl
    ssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherf
    irvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitglsgsg
    payiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvtspggt
    tiagvhelekagfrgilmnavvaaakrsqels
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5bsgF (F:)
    snameiipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesi
    gitvlssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewa
    gherfirvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitg
    lsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvt
    spggttiagvhelekagfrgilmnavvaaakrsqels
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bsgF (F:)
    iipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvl
    ssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherf
    irvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitglsgsg
    payiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvtspggt
    tiagvhelekagfrgilmnavvaaakrsqels
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5bsgG (G:)
    snameiipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesi
    gitvlssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewa
    gherfirvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitg
    lsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvt
    spggttiagvhelekagfrgilmnavvaaakrsqels
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bsgG (G:)
    ipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvlssn
    ddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherfirv
    mpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitglsgsgpay
    iylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvtspggttia
    gvhelekagfrgilmnavvaaakrsqels
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5bsgH (H:)
    snameiipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesi
    gitvlssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewa
    gherfirvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitg
    lsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvt
    spggttiagvhelekagfrgilmnavvaaakrsqels
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bsgH (H:)
    iipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvl
    ssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherf
    irvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitglsgsg
    payiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvtspggt
    tiagvhelekagfrgilmnavvaaakrsqels
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5bsgI (I:)
    snameiipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesi
    gitvlssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewa
    gherfirvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitg
    lsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvt
    spggttiagvhelekagfrgilmnavvaaakrsqels
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bsgI (I:)
    iipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvl
    ssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherf
    irvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitglsgsg
    payiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvtspggt
    tiagvhelekagfrgilmnavvaaakrsqels
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5bsgJ (J:)
    snameiipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesi
    gitvlssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewa
    gherfirvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitg
    lsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvt
    spggttiagvhelekagfrgilmnavvaaakrsqels
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bsgJ (J:)
    pipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvlss
    nddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherfir
    vmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitglsgsgpa
    yiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvtspggtti
    agvhelekagfrgilmnavvaaakrsqels