PDB entry 5bsf

View 5bsf on RCSB PDB site
Description: Crystal structure of Medicago truncatula (delta)1-Pyrroline-5-Carboxylate Reductase (MtP5CR) in complex with NAD+
Class: oxidoreductase
Keywords: proline biosynthesis, decamer, P5C, plant protein, OXIDOREDUCTASE
Deposited on 2015-06-02, released 2015-11-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-11-11, with a file datestamp of 2015-11-06.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyrroline-5-carboxylate reductase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_7g090160
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5bsfa1, d5bsfa2
  • Chain 'B':
    Compound: pyrroline-5-carboxylate reductase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_7g090160
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5bsfb1, d5bsfb2
  • Chain 'C':
    Compound: pyrroline-5-carboxylate reductase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_7g090160
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5bsfc1, d5bsfc2
  • Chain 'D':
    Compound: pyrroline-5-carboxylate reductase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_7g090160
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5bsfd1, d5bsfd2
  • Chain 'E':
    Compound: pyrroline-5-carboxylate reductase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_7g090160
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5bsfe1, d5bsfe2
  • Chain 'F':
    Compound: pyrroline-5-carboxylate reductase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_7g090160
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5bsff1, d5bsff2
  • Chain 'G':
    Compound: pyrroline-5-carboxylate reductase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_7g090160
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5bsfg1, d5bsfg2
  • Chain 'H':
    Compound: pyrroline-5-carboxylate reductase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_7g090160
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5bsfh1, d5bsfh2
  • Chain 'I':
    Compound: pyrroline-5-carboxylate reductase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_7g090160
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5bsfi1, d5bsfi2
  • Chain 'J':
    Compound: pyrroline-5-carboxylate reductase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_7g090160
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5bsfj1, d5bsfj2
  • Heterogens: NAD, MPO, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5bsfA (A:)
    snameiipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesi
    gitvlssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewa
    gherfirvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitg
    lsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvt
    spggttiagvhelekagfrgilmnavvaaakrsqels
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bsfA (A:)
    iipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvl
    ssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherf
    irvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitglsgsg
    payiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvtspggt
    tiagvhelekagfrgilmnavvaaakrsqels
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5bsfB (B:)
    snameiipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesi
    gitvlssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewa
    gherfirvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitg
    lsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvt
    spggttiagvhelekagfrgilmnavvaaakrsqels
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bsfB (B:)
    iipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvl
    ssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherf
    irvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitglsgsg
    payiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvtspggt
    tiagvhelekagfrgilmnavvaaakrsqels
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5bsfC (C:)
    snameiipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesi
    gitvlssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewa
    gherfirvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitg
    lsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvt
    spggttiagvhelekagfrgilmnavvaaakrsqels
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bsfC (C:)
    pipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvlss
    nddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherfir
    vmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitglsgsgpa
    yiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvtspggtti
    agvhelekagfrgilmnavvaaakrsqels
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5bsfD (D:)
    snameiipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesi
    gitvlssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewa
    gherfirvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitg
    lsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvt
    spggttiagvhelekagfrgilmnavvaaakrsqels
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bsfD (D:)
    ipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvls
    snddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherfi
    rvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitglsgsgp
    ayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvtspggtt
    iagvhelekagfrgilmnavvaaakrsqels
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5bsfE (E:)
    snameiipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesi
    gitvlssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewa
    gherfirvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitg
    lsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvt
    spggttiagvhelekagfrgilmnavvaaakrsqels
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bsfE (E:)
    iipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvl
    ssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherf
    irvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitglsgsg
    payiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvtspggt
    tiagvhelekagfrgilmnavvaaakrsqels
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5bsfF (F:)
    snameiipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesi
    gitvlssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewa
    gherfirvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitg
    lsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvt
    spggttiagvhelekagfrgilmnavvaaakrsqels
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bsfF (F:)
    iipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvl
    ssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherf
    irvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitglsgsg
    payiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvtspggt
    tiagvhelekagfrgilmnavvaaakrsqels
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5bsfG (G:)
    snameiipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesi
    gitvlssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewa
    gherfirvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitg
    lsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvt
    spggttiagvhelekagfrgilmnavvaaakrsqels
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bsfG (G:)
    padsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvlssnd
    dvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherfirvm
    pntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitglsgsgpayi
    ylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvtspggttiag
    vhelekagfrgilmnavvaaakrsqels
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5bsfH (H:)
    snameiipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesi
    gitvlssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewa
    gherfirvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitg
    lsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvt
    spggttiagvhelekagfrgilmnavvaaakrsqels
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bsfH (H:)
    iipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvl
    ssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherf
    irvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitglsgsg
    payiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvtspggt
    tiagvhelekagfrgilmnavvaaakrsqels
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5bsfI (I:)
    snameiipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesi
    gitvlssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewa
    gherfirvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitg
    lsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvt
    spggttiagvhelekagfrgilmnavvaaakrsqels
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bsfI (I:)
    iipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvl
    ssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherf
    irvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitglsgsg
    payiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvtspggt
    tiagvhelekagfrgilmnavvaaakrsqels
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5bsfJ (J:)
    snameiipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesi
    gitvlssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewa
    gherfirvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitg
    lsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvt
    spggttiagvhelekagfrgilmnavvaaakrsqels
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bsfJ (J:)
    iipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvl
    ssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherf
    irvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitglsgsg
    payiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvtspggt
    tiagvhelekagfrgilmnavvaaakrsqels