PDB entry 5bse

View 5bse on RCSB PDB site
Description: Crystal structure of Medicago truncatula (delta)1-Pyrroline-5-Carboxylate Reductase (MtP5CR)
Class: oxidoreductase
Keywords: proline biosynthesis, decamer, P5C, plant protein, OXIDOREDUCTASE
Deposited on 2015-06-02, released 2015-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-12-02, with a file datestamp of 2015-11-27.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyrroline-5-carboxylate reductase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_7g090160
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5bsea1, d5bsea2
  • Chain 'B':
    Compound: pyrroline-5-carboxylate reductase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_7g090160
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5bseb1, d5bseb2
  • Chain 'C':
    Compound: pyrroline-5-carboxylate reductase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_7g090160
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5bsec1, d5bsec2
  • Chain 'D':
    Compound: pyrroline-5-carboxylate reductase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_7g090160
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5bsed1, d5bsed2
  • Chain 'E':
    Compound: pyrroline-5-carboxylate reductase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_7g090160
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5bsee1, d5bsee2
  • Chain 'F':
    Compound: pyrroline-5-carboxylate reductase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_7g090160
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5bsef1, d5bsef2
  • Chain 'G':
    Compound: pyrroline-5-carboxylate reductase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_7g090160
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5bseg1, d5bseg2
  • Chain 'H':
    Compound: pyrroline-5-carboxylate reductase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_7g090160
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5bseh1, d5bseh2
  • Chain 'I':
    Compound: pyrroline-5-carboxylate reductase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_7g090160
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5bsei1, d5bsei2
  • Chain 'J':
    Compound: pyrroline-5-carboxylate reductase
    Species: Medicago truncatula [TaxId:3880]
    Gene: MTR_7g090160
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5bsej1, d5bsej2
  • Heterogens: MPO, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5bseA (A:)
    snameiipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesi
    gitvlssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewa
    gherfirvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitg
    lsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvt
    spggttiagvhelekagfrgilmnavvaaakrsqels
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bseA (A:)
    iipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvl
    ssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherf
    irvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitglsgsg
    payiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvtspggt
    tiagvhelekagfrgilmnavvaaakrsqels
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5bseB (B:)
    snameiipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesi
    gitvlssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewa
    gherfirvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitg
    lsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvt
    spggttiagvhelekagfrgilmnavvaaakrsqels
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bseB (B:)
    iipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvl
    ssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherf
    irvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitglsgsg
    payiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvtspggt
    tiagvhelekagfrgilmnavvaaakrsqels
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5bseC (C:)
    snameiipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesi
    gitvlssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewa
    gherfirvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitg
    lsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvt
    spggttiagvhelekagfrgilmnavvaaakrsqels
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bseC (C:)
    iipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvl
    ssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherf
    irvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitglsgsg
    payiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvtspggt
    tiagvhelekagfrgilmnavvaaakrsqels
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5bseD (D:)
    snameiipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesi
    gitvlssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewa
    gherfirvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitg
    lsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvt
    spggttiagvhelekagfrgilmnavvaaakrsqels
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bseD (D:)
    pipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvlss
    nddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherfir
    vmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitglsgsgpa
    yiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvtspggtti
    agvhelekagfrgilmnavvaaakrsqels
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5bseE (E:)
    snameiipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesi
    gitvlssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewa
    gherfirvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitg
    lsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvt
    spggttiagvhelekagfrgilmnavvaaakrsqels
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bseE (E:)
    iipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvl
    ssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherf
    irvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitglsgsg
    payiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvtspggt
    tiagvhelekagfrgilmnavvaaakrsqels
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5bseF (F:)
    snameiipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesi
    gitvlssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewa
    gherfirvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitg
    lsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvt
    spggttiagvhelekagfrgilmnavvaaakrsqels
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bseF (F:)
    iipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvl
    ssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherf
    irvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitglsgsg
    payiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvtspggt
    tiagvhelekagfrgilmnavvaaakrsqels
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5bseG (G:)
    snameiipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesi
    gitvlssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewa
    gherfirvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitg
    lsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvt
    spggttiagvhelekagfrgilmnavvaaakrsqels
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bseG (G:)
    padsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvlssnd
    dvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherfirvm
    pntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitglsgsgpayi
    ylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvtspggttiag
    vhelekagfrgilmnavvaaakrsqels
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5bseH (H:)
    snameiipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesi
    gitvlssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewa
    gherfirvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitg
    lsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvt
    spggttiagvhelekagfrgilmnavvaaakrsqels
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bseH (H:)
    iipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvl
    ssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherf
    irvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitglsgsg
    payiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvtspggt
    tiagvhelekagfrgilmnavvaaakrsqels
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5bseI (I:)
    snameiipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesi
    gitvlssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewa
    gherfirvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitg
    lsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvt
    spggttiagvhelekagfrgilmnavvaaakrsqels
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bseI (I:)
    iipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvl
    ssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherf
    irvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitglsgsg
    payiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvtspggt
    tiagvhelekagfrgilmnavvaaakrsqels
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5bseJ (J:)
    snameiipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesi
    gitvlssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewa
    gherfirvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitg
    lsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvt
    spggttiagvhelekagfrgilmnavvaaakrsqels
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bseJ (J:)
    iipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvl
    ssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherf
    irvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkaddkyfdaitglsgsg
    payiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhpgqlkddvtspggt
    tiagvhelekagfrgilmnavvaaakrsqels