PDB entry 5bs9

View 5bs9 on RCSB PDB site
Description: Crystal structure of N109A mutant of human macrophage migration inhibitory factor
Class: isomerase
Keywords: Isomerase, surface, mutation
Deposited on 2015-06-01, released 2015-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-30, with a file datestamp of 2015-09-25.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: MIF, GLIF, MMIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14174 (0-113)
      • engineered mutation (108)
    Domains in SCOPe 2.07: d5bs9a_
  • Chain 'B':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: MIF, GLIF, MMIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14174 (0-113)
      • engineered mutation (108)
    Domains in SCOPe 2.07: d5bs9b_
  • Chain 'C':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: MIF, GLIF, MMIF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14174 (0-113)
      • engineered mutation (108)
    Domains in SCOPe 2.07: d5bs9c_
  • Heterogens: SO4, IPA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5bs9A (A:)
    pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
    lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwanstfa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5bs9B (B:)
    pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
    lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwanstfa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5bs9C (C:)
    pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
    lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwanstfa