PDB entry 5bs6

View 5bs6 on RCSB PDB site
Description: Apo structure of transcriptional factor AraR from Bacteroides thetaiotaomicron VPI
Class: transcription
Keywords: Structural Genomics, PSI-Biology, Midwest Center for Structural Genomics, MCSG, transcriptional regulator, Bacteroides thetaiotaomicron, helix-turn-helix motif, Nudix fold, DNA binding, TRANSCRIPTION
Deposited on 2015-06-01, released 2015-06-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-12-16, with a file datestamp of 2015-12-11.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcriptional regulator AraR
    Species: Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) [TaxId:226186]
    Gene: BT_0354
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5bs6a1, d5bs6a2
  • Chain 'B':
    Compound: transcriptional regulator AraR
    Species: Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) [TaxId:226186]
    Gene: BT_0354
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8AAV8 (3-227)
      • expression tag (2)
    Domains in SCOPe 2.08: d5bs6b1, d5bs6b2, d5bs6b3
  • Chain 'C':
    Compound: transcriptional regulator AraR
    Species: Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) [TaxId:226186]
    Gene: BT_0354
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8AAV8 (3-227)
      • expression tag (2)
    Domains in SCOPe 2.08: d5bs6c1, d5bs6c2, d5bs6c3
  • Chain 'D':
    Compound: transcriptional regulator AraR
    Species: Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) [TaxId:226186]
    Gene: BT_0354
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8AAV8 (3-227)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d5bs6d1, d5bs6d2, d5bs6d3
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5bs6A (A:)
    snamknyyssnptfylgidciifgfnegeisllllkrnfepamgewslmggfvqkdesvd
    daakrvlaeltglenvymeqvgafgaidrdpgervvsiayyalinineydrelvqkhnay
    wvninelpalifdhpemvdkaremmkqkasvepigfnllpklftlsqlqslyeaiygepm
    dkrnfrkrvaemdfiektdkidklgskrgaalykfngkayrkdpkfkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bs6A (A:)
    nyyssnptfylgidciifgfnegeisllllkrnfepamgewslmggfvqkdesvddaakr
    vlaeltglenvymeqvgafgaidrdpgervvsiayyalinineydrelvqkhnaywvnin
    elpalifdhpemvdkaremmkqkasvepigfnllpklftlsqlqslyeaiygepmdkrnf
    rkrvaemdfiektdkidklgskrgaalykfngkayrkdpkfkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5bs6B (B:)
    snamknyyssnptfylgidciifgfnegeisllllkrnfepamgewslmggfvqkdesvd
    daakrvlaeltglenvymeqvgafgaidrdpgervvsiayyalinineydrelvqkhnay
    wvninelpalifdhpemvdkaremmkqkasvepigfnllpklftlsqlqslyeaiygepm
    dkrnfrkrvaemdfiektdkidklgskrgaalykfngkayrkdpkfkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bs6B (B:)
    amknyyssnptfylgidciifgfnegeisllllkrnfepamgewslmggfvqkdesvdda
    akrvlaeltglenvymeqvgafgaidrdpgervvsiayyalinineydrelvqkhnaywv
    ninelpalifdhpemvdkaremmkqkasvepigfnllpklftlsqlqslyeaiygepmdk
    rnfrkrvaemdfiektdkidklgskrgaalykfngkayrkdpfkl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5bs6C (C:)
    snamknyyssnptfylgidciifgfnegeisllllkrnfepamgewslmggfvqkdesvd
    daakrvlaeltglenvymeqvgafgaidrdpgervvsiayyalinineydrelvqkhnay
    wvninelpalifdhpemvdkaremmkqkasvepigfnllpklftlsqlqslyeaiygepm
    dkrnfrkrvaemdfiektdkidklgskrgaalykfngkayrkdpkfkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bs6C (C:)
    amknyyssnptfylgidciifgfnegeisllllkrnfepamgewslmggfvqkdesvdda
    akrvlaeltglenvymeqvgafgaidrdpgervvsiayyalinineydrelvqkhnaywv
    ninelpalifdhpemvdkaremmkqkasvepigfnllpklftlsqlqslyeaiygepmdk
    rnfrkrvaemdfiektdkidklgskrgaalykfngkayrkdpkfkl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5bs6D (D:)
    snamknyyssnptfylgidciifgfnegeisllllkrnfepamgewslmggfvqkdesvd
    daakrvlaeltglenvymeqvgafgaidrdpgervvsiayyalinineydrelvqkhnay
    wvninelpalifdhpemvdkaremmkqkasvepigfnllpklftlsqlqslyeaiygepm
    dkrnfrkrvaemdfiektdkidklgskrgaalykfngkayrkdpkfkl