PDB entry 5brx

View 5brx on RCSB PDB site
Description: X-ray crystal structure of Aplysia californica (Ac-AChBP) in complex with 2-pyridyl azatricyclo[3.3.1.13,7]decane; 2-pyridylazaadamantane; 2-Aza (TI-8480)
Class: acetylcholine binding protein
Keywords: AChBP, nicotine, acetylcholine, ACETYLCHOLINE BINDING PROTEIN
Deposited on 2015-06-01, released 2015-06-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-06-24, with a file datestamp of 2015-06-19.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8 (9-End)
      • expression tag (5-8)
      • engineered mutation (63)
    Domains in SCOPe 2.07: d5brxa1, d5brxa2
  • Chain 'B':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8 (9-End)
      • expression tag (1-8)
      • engineered mutation (63)
    Domains in SCOPe 2.07: d5brxb1, d5brxb2
  • Chain 'C':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8 (9-End)
      • expression tag (5-8)
      • engineered mutation (63)
    Domains in SCOPe 2.07: d5brxc1, d5brxc2
  • Chain 'D':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8 (9-End)
      • expression tag (1-8)
      • engineered mutation (63)
    Domains in SCOPe 2.07: d5brxd1, d5brxd2
  • Chain 'E':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8 (9-End)
      • expression tag (3-8)
      • engineered mutation (63)
    Domains in SCOPe 2.07: d5brxe1, d5brxe2
  • Chain 'F':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8 (9-End)
      • expression tag (4-8)
      • engineered mutation (63)
    Domains in SCOPe 2.07: d5brxf1, d5brxf2
  • Chain 'G':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8 (9-End)
      • expression tag (1-8)
      • engineered mutation (63)
    Domains in SCOPe 2.07: d5brxg1, d5brxg2
  • Chain 'H':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8 (9-End)
      • expression tag (5-8)
      • engineered mutation (63)
    Domains in SCOPe 2.07: d5brxh1, d5brxh2
  • Chain 'I':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8 (9-End)
      • expression tag (1-8)
      • engineered mutation (63)
    Domains in SCOPe 2.07: d5brxi1, d5brxi2
  • Chain 'J':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8 (9-End)
      • expression tag (3-8)
      • engineered mutation (63)
    Domains in SCOPe 2.07: d5brxj1, d5brxj2
  • Heterogens: SO4, TI4, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5brxA (A:)
    dykddddklhsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevd
    lvyweqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvth
    dgsvmfipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyas
    skyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5brxA (A:)
    ddklhsqanlmrlksdlfnrsypgptkddpltvtlgftlqdivkadsstnevdlvyweqq
    rwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfi
    paqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeils
    atqtrqvqhysccpepyidvnlvvkfrer
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5brxB (B:)
    dykddddklhsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevd
    lvyweqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvth
    dgsvmfipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyas
    skyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5brxB (B:)
    ykddddklhsqanlmrlksdlfnrypgptkddpltvtlgftlqdivkadsstnevdlvyw
    eqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsv
    mfipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskye
    ilsatqtrqvqhysccpepyidvnlvvkfrer
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5brxC (C:)
    dykddddklhsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevd
    lvyweqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvth
    dgsvmfipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyas
    skyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5brxC (C:)
    ddklhsqanlmrlksdlfnrsypgptkddpltvtlgftlqdivkadsstnevdlvyweqq
    rwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfi
    paqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeils
    atqtrqvqhysccpepyidvnlvvkfrer
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5brxD (D:)
    dykddddklhsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevd
    lvyweqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvth
    dgsvmfipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyas
    skyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5brxD (D:)
    ykddddklhsqanlmrlksdlfnrsmypgptkddpltvtlgftlqdivkadsstnevdlv
    yweqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdg
    svmfipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyassk
    yeilsatqtrqvqhysccpepyidvnlvvkfrer
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5brxE (E:)
    dykddddklhsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevd
    lvyweqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvth
    dgsvmfipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyas
    skyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5brxE (E:)
    ddddklhsqanlmrlksdlfnypgptkddpltvtlgftlqdivkadsstnevdlvyweqq
    rwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfi
    paqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeils
    atqtrqvqhysccpepyidvnlvvkfrer
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5brxF (F:)
    dykddddklhsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevd
    lvyweqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvth
    dgsvmfipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyas
    skyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5brxF (F:)
    dddklhsqanlmrlksdlfnrypgptkddpltvtlgftlqdivkadsstnevdlvyweqq
    rwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfi
    paqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeils
    atqtrqvqhysccpepyidvnlvvkfrer
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5brxG (G:)
    dykddddklhsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevd
    lvyweqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvth
    dgsvmfipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyas
    skyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5brxG (G:)
    ykddddklhsqanlmrlksdlfnrypgptkddpltvtlgftlqdivkadsstnevdlvyw
    eqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsv
    mfipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskye
    ilsatqtrqvqhysccpepyidvnlvvkfrer
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5brxH (H:)
    dykddddklhsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevd
    lvyweqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvth
    dgsvmfipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyas
    skyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5brxH (H:)
    ddklhsqanlmrlksdlfnrypgptkddpltvtlgftlqdivkadsstnevdlvyweqqr
    wklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfip
    aqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsa
    tqtrqvqhysccpepyidvnlvvkfrer
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5brxI (I:)
    dykddddklhsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevd
    lvyweqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvth
    dgsvmfipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyas
    skyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5brxI (I:)
    ykddddklhsqanlmrlksdlfnrsmypgptkddpltvtlgftlqdivkadsstnevdlv
    yweqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdg
    svmfipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyassk
    yeilsatqtrqvqhysccpepyidvnlvvkfrer
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5brxJ (J:)
    dykddddklhsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevd
    lvyweqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvth
    dgsvmfipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyas
    skyeilsatqtrqvqhysccpepyidvnlvvkfrerragngffrnlfdsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5brxJ (J:)
    ddddklhsqanlmrlksdlfnypgptkddpltvtlgftlqdivkadsstnevdlvyweqq
    rwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfi
    paqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeils
    atqtrqvqhysccpepyidvnlvvkfrer