PDB entry 5brr

View 5brr on RCSB PDB site
Description: Michaelis complex of tPA-S195A:PAI-1
Class: hydrolase inhibitor/hydrolase
Keywords: Tissue-Type Plasminogen Activator Catalytic Domain, Plasminogen Activator Inhibitor 1, Structure-Activity Relationship, Thrombolysis, HYDROLASE INHIBITOR-HYDROLASE complex
Deposited on 2015-06-01, released 2015-09-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-11-11, with a file datestamp of 2015-11-06.
Experiment type: XRAY
Resolution: 3.16 Å
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: tissue-type plasminogen activator
    Species: Homo sapiens [TaxId:9606]
    Gene: PLAT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00750 (0-End)
      • engineered mutation (119)
      • engineered mutation (172)
      • engineered mutation (202)
  • Chain 'I':
    Compound: Plasminogen activator inhibitor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SERPINE1, PAI1, PLANH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05121 (Start-378)
      • engineered mutation (149)
      • engineered mutation (153)
      • engineered mutation (318)
      • engineered mutation (353)
    Domains in SCOPe 2.06: d5brri_
  • Heterogens: GOL, PGE, HOH

PDB Chain Sequences:

  • Chain 'E':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5brrI (I:)
    vhhppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqa
    amgfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrst
    vkqvdfseverarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfp
    dssthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaap
    yekevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfr
    qfqadftslsdqeplhvalalqkvkievnesgtvassstavivsarmapeeiiidrpflf
    vvrhnptgtvlfmgqvmep
    

    Sequence, based on observed residues (ATOM records): (download)
    >5brrI (I:)
    vahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamgfkid
    dkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkqvdfs
    everarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfpdssthrr
    lfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyekevpl
    saltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfqadft
    slsdqeplhvalalqkvkievnesgtvassstavivsarmapeeiiidrpflfvvrhnpt
    gtvlfmgqvmep