PDB entry 5brn

View 5brn on RCSB PDB site
Description: Human HGPRT in complex with (S)-HPEPHx, an acyclic nucleoside phosphonate
Class: TRANSFERASE/TRANSFERASE Inhibitor
Keywords: Hypoxanthine-guanine-xanthine phosphoribosyltransferase, acyclic nuclesoside phosphonates, inhibitor, TRANSFERASE-TRANSFERASE Inhibitor complex
Deposited on 2015-05-31, released 2015-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-10-14, with a file datestamp of 2015-10-09.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypoxanthine-guanine phosphoribosyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: HPRT1, HPRT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00492
      • engineered mutation (22)
      • engineered mutation (205)
    Domains in SCOPe 2.07: d5brna_
  • Chain 'B':
    Compound: hypoxanthine-guanine phosphoribosyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: HPRT1, HPRT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00492 (Start-217)
      • engineered mutation (22)
      • engineered mutation (205)
    Domains in SCOPe 2.07: d5brnb_
  • Chain 'C':
    Compound: hypoxanthine-guanine phosphoribosyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: HPRT1, HPRT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00492 (Start-217)
      • engineered mutation (22)
      • engineered mutation (205)
    Domains in SCOPe 2.07: d5brnc_
  • Chain 'D':
    Compound: hypoxanthine-guanine phosphoribosyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: HPRT1, HPRT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00492 (Start-217)
      • engineered mutation (22)
      • engineered mutation (205)
    Domains in SCOPe 2.07: d5brnd_
  • Heterogens: MG, 4X2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5brnA (A:)
    matrspgvvisddepgydldlfaipnhyaedlervfiphglimdrterlardvmkemggh
    hivalcvlkggykffadlldyikalnrnsdrsipmtvdfirlksyandqstgdikviggd
    dlstltgknvlivediidtgktmqtllslvrqynpkmvkvasllvkrtprsvgykpdfvg
    feipdkfvvgyaldyneyfrdlnhvavisetgkakyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >5brnA (A:)
    spgvvisddepgydldlfaipnhyaedlervfiphglimdrterlardvmkemgghhiva
    lcvlkggykffadlldyikalnrnsdrsipmtvdfirllstltgknvlivediidtgktm
    qtllslvrqynpkmvkvasllvkrtprsvgykpdfvgfeipdkfvvgyaldyneyfrdln
    hvavisetgkakyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5brnB (B:)
    matrspgvvisddepgydldlfaipnhyaedlervfiphglimdrterlardvmkemggh
    hivalcvlkggykffadlldyikalnrnsdrsipmtvdfirlksyandqstgdikviggd
    dlstltgknvlivediidtgktmqtllslvrqynpkmvkvasllvkrtprsvgykpdfvg
    feipdkfvvgyaldyneyfrdlnhvavisetgkakyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >5brnB (B:)
    spgvvisddepgydldlfaipnhyaedlervfiphglimdrterlardvmkemgghhiva
    lcvlkggykffadlldyikalnrnsdrsipmtvdfirldlstltgknvlivediidtgkt
    mqtllslvrqynpkmvkvasllvkrrsvgykpdfvgfeipdkfvvgyaldyneyfrdlnh
    vavisetgkakyka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5brnC (C:)
    matrspgvvisddepgydldlfaipnhyaedlervfiphglimdrterlardvmkemggh
    hivalcvlkggykffadlldyikalnrnsdrsipmtvdfirlksyandqstgdikviggd
    dlstltgknvlivediidtgktmqtllslvrqynpkmvkvasllvkrtprsvgykpdfvg
    feipdkfvvgyaldyneyfrdlnhvavisetgkakyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >5brnC (C:)
    gvvisddepgydldlfaipnhyaedlervfiphglimdrterlardvmkemgghhivalc
    vlkggykffadlldyikalnrnsdrsipmtvdfirlksystltgknvlivediidtgktm
    qtllslvrqynpkmvkvasllvkrtprsvgykpdfvgfeipdkfvvgyaldyneyfrdln
    hvavisetgkakyka
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5brnD (D:)
    matrspgvvisddepgydldlfaipnhyaedlervfiphglimdrterlardvmkemggh
    hivalcvlkggykffadlldyikalnrnsdrsipmtvdfirlksyandqstgdikviggd
    dlstltgknvlivediidtgktmqtllslvrqynpkmvkvasllvkrtprsvgykpdfvg
    feipdkfvvgyaldyneyfrdlnhvavisetgkakyka
    

    Sequence, based on observed residues (ATOM records): (download)
    >5brnD (D:)
    spgvvisddepgydldlfaipnhyaedlervfiphglimdrterlardvmkemgghhiva
    lcvlkggykffadlldyikalnrnsdrsipmtvdfirlddlstltgknvlivediidtgk
    tmqtllslvrqynpkmvkvasllvkrtprsvgykpdfvgfeipdkfvvgyaldyneyfrd
    lnhvavisetgkakyka