PDB entry 5brk

View 5brk on RCSB PDB site
Description: pMob1-Lats1 complex
Class: Transferase/Signaling protein
Keywords: pMob1, Lats1, Hippo, Transferase-Signaling protein complex
Deposited on 2015-05-31, released 2015-07-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MOB kinase activator 1A
    Species: Homo sapiens [TaxId:9606]
    Gene: MOB1A, C2orf6, MOB4B, MOBK1B, MOBKL1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5brka_
  • Chain 'B':
    Compound: Serine/threonine-protein kinase LATS1
    Species: Homo sapiens [TaxId:9606]
    Gene: LATS1, WARTS
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5brkA (A:)
    gmsflfssrssktfkpkknipegshqyellkhaeatlgsgnlrqavmlpegedlnewiav
    ntvdffnqinmlygtitefcteascpvmsagpryeyhwadgtnikkpikcsapkyidylm
    twvqdqlddetlfpskigvpfpknfmsvaktilkrlfrvyahiyhqhfdsvmqlqeeahl
    ntsfkhfiffvqefnlidrrelaplqelieklgskdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5brkA (A:)
    sktfkpkknipeellkhaeatlgsgnlrqavmlpegedlnewiavntvdffnqinmlygt
    itefcteascpvmsagpryeyhwadgtpikcsapkyidylmtwvqdqlddetlfpskigv
    pfpknfmsvaktilkrlfrvyahiyhqhfdsvmqlqeeahlntsfkhfiffvqefnlidr
    relaplqelieklg
    

  • Chain 'B':
    No sequence available.