PDB entry 5brb

View 5brb on RCSB PDB site
Description: Crystal structure of Q64E mutant of Triosephosphate isomerase from Plasmodium falciparum
Class: isomerase
Keywords: TIM barrel, Isomerase
Deposited on 2015-05-30, released 2015-07-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-07-29, with a file datestamp of 2015-07-24.
Experiment type: XRAY
Resolution: 2.53 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: tpi
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07412 (Start-247)
      • engineered mutation (63)
      • engineered mutation (162)
    Domains in SCOPe 2.05: d5brba_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: tpi
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07412 (Start-247)
      • engineered mutation (63)
      • engineered mutation (162)
    Domains in SCOPe 2.05: d5brbb_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5brbA (A:)
    markyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfs
    tgienvskfgngsytgevsaeiakdlnieyviighferrkyfhetdedvreklqaslknn
    lkavvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeq
    aqlvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesf
    vdiiksam
    

    Sequence, based on observed residues (ATOM records): (download)
    >5brbA (A:)
    rkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfstg
    ienvskfgngsytgevsaeiakdlnieyviighferrkyfhetdedvreklqaslknnlk
    avvcfgesleqrnktievitkqvkafvdlidnfdnvilvyeplwagtgktatpeqaqlvh
    keirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfvdiik
    sam
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5brbB (B:)
    markyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfs
    tgienvskfgngsytgevsaeiakdlnieyviighferrkyfhetdedvreklqaslknn
    lkavvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeq
    aqlvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesf
    vdiiksam
    

    Sequence, based on observed residues (ATOM records): (download)
    >5brbB (B:)
    rkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfstg
    ienvfgngsytgevsaeiakdlnieyviighferrkyfhetdedvreklqaslknnlkav
    vcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaitgktatpeqaqlvh
    keirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfvdiik
    sam