PDB entry 5br3

View 5br3 on RCSB PDB site
Description: Crystal structure of hemagglutinin of A/Taiwan/2/2013 (H6N1) in complex with LSTa
Class: viral protein
Keywords: influenza, heamgglutinin, VIRAL PROTEIN
Deposited on 2015-05-29, released 2015-08-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-08-12, with a file datestamp of 2015-08-07.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • PDB 5BR3 (0-325)
    Domains in SCOPe 2.05: d5br3a_
  • Chain 'B':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • PDB 5BR3 (0-170)
    Domains in SCOPe 2.05: d5br3b_
  • Chain 'C':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • PDB 5BR3 (0-325)
    Domains in SCOPe 2.05: d5br3c_
  • Chain 'D':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • PDB 5BR3 (0-170)
    Domains in SCOPe 2.05: d5br3d_
  • Heterogens: NAG, SIA, GAL, FUC, BMA, MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5br3A (A:)
    dkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctiegw
    ilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfpks
    twagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpilyfwgv
    hhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpget
    lnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqnvspl
    wigecpkyvkseslrlatglrnvpqi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5br3B (B:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5br3C (C:)
    dkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctiegw
    ilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfpks
    twagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpilyfwgv
    hhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpget
    lnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqnvspl
    wigecpkyvkseslrlatglrnvpqi
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5br3D (D:)
    gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
    tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
    kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrq