PDB entry 5bqz

View 5bqz on RCSB PDB site
Description: Crystal structure of hemagglutinin of A/Chicken/Guangdong/S1311/2010 (H6N6) in complex with human-like receptor LSTc
Class: viral protein
Keywords: influenza, heamgglutinin, VIRAL PROTEIN
Deposited on 2015-05-29, released 2015-10-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-10-14, with a file datestamp of 2015-10-09.
Experiment type: XRAY
Resolution: 2.89 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus (A/chicken/Guangdong/S1311/2010(H6N6)) [TaxId:1454272]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5bqza_
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/chicken/Guangdong/S1311/2010(H6N6)) [TaxId:1454272]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5bqzb_
  • Chain 'C':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus (A/chicken/Guangdong/S1311/2010(H6N6)) [TaxId:1454272]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5bqzc_
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/chicken/Guangdong/S1311/2010(H6N6)) [TaxId:1454272]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5bqzd_
  • Chain 'E':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus (A/chicken/Guangdong/S1311/2010(H6N6)) [TaxId:1454272]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5bqze_
  • Chain 'F':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/chicken/Guangdong/S1311/2010(H6N6)) [TaxId:1454272]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5bqzf_
  • Heterogens: NAG, SIA, GAL

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5bqzA (A:)
    dkicigyhannsttkvdtileknvtvthsvellenqkeerfckisnkapldlrdctlegw
    ilgnprcgilladqswsyiverpnarngicypgtlneaeelkaligsgerverfemfpks
    twtgvntesgvssacplgngpsfyrnllwiiklksseypvirgtfnntgdksilyfwgvh
    hppvtteqnalygsgdryvrmgtesmnfarspeiaarpavngqrgridyfwsilkpgetl
    nvesngnliapwyayrfvnkdskgaifrsnlpiencdatcqttegvirtnktfqnvsplw
    igecpkyvkskslrlatglrnvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5bqzB (B:)
    glfgaiagfieggwtgmidgwygyhhensqgsgyaadkestqkaidgitnkvnsiidkmn
    tqfeavghefsnlerridnlnkrmedgfldvwtynaellvllenertldlhdanvknlhe
    kvrsqlrdnandlgngcfefwhkcnnecmesvkngtydypkyqkesrlnrqkiesvklen
    fdvyqgalvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bqzB (B:)
    glfgaiagfieggwtgmidgwygyhhensqgsgyaadkestqkaidgitnkvnsiidkmn
    tqfeavghefsnlerridnlnkrmedgfldvwtynaellvllenertldlhdanvknlhe
    kvrsqlrdnandlgngcfefwhkcnnecmesvkngtydypkyqkesrlnr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5bqzC (C:)
    dkicigyhannsttkvdtileknvtvthsvellenqkeerfckisnkapldlrdctlegw
    ilgnprcgilladqswsyiverpnarngicypgtlneaeelkaligsgerverfemfpks
    twtgvntesgvssacplgngpsfyrnllwiiklksseypvirgtfnntgdksilyfwgvh
    hppvtteqnalygsgdryvrmgtesmnfarspeiaarpavngqrgridyfwsilkpgetl
    nvesngnliapwyayrfvnkdskgaifrsnlpiencdatcqttegvirtnktfqnvsplw
    igecpkyvkskslrlatglrnvp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5bqzD (D:)
    glfgaiagfieggwtgmidgwygyhhensqgsgyaadkestqkaidgitnkvnsiidkmn
    tqfeavghefsnlerridnlnkrmedgfldvwtynaellvllenertldlhdanvknlhe
    kvrsqlrdnandlgngcfefwhkcnnecmesvkngtydypkyqkesrlnrqkiesvklen
    fdvyqgalvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bqzD (D:)
    glfgaiagfieggwtgmidgwygyhhensqgsgyaadkestqkaidgitnkvnsiidkmn
    tqfeavghefsnlerridnlnkrmedgfldvwtynaellvllenertldlhdanvknlhe
    kvrsqlrdnandlgngcfefwhkcnnecmesvkngtydypkyqkesrlnrqki
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5bqzE (E:)
    dkicigyhannsttkvdtileknvtvthsvellenqkeerfckisnkapldlrdctlegw
    ilgnprcgilladqswsyiverpnarngicypgtlneaeelkaligsgerverfemfpks
    twtgvntesgvssacplgngpsfyrnllwiiklksseypvirgtfnntgdksilyfwgvh
    hppvtteqnalygsgdryvrmgtesmnfarspeiaarpavngqrgridyfwsilkpgetl
    nvesngnliapwyayrfvnkdskgaifrsnlpiencdatcqttegvirtnktfqnvsplw
    igecpkyvkskslrlatglrnvp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5bqzF (F:)
    glfgaiagfieggwtgmidgwygyhhensqgsgyaadkestqkaidgitnkvnsiidkmn
    tqfeavghefsnlerridnlnkrmedgfldvwtynaellvllenertldlhdanvknlhe
    kvrsqlrdnandlgngcfefwhkcnnecmesvkngtydypkyqkesrlnrqkiesvklen
    fdvyqgalvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bqzF (F:)
    glfgaiagfieggwtgmidgwygyhhensqgsgyaadkestqkaidgitnkvnsiidkmn
    tqfeavghefsnlerridnlnkrmedgfldvwtynaellvllenertldlhdanvknlhe
    kvrsqlrdnandlgngcfefwhkcnnecmesvkngtydypkyqkesrln