PDB entry 5bqy

View 5bqy on RCSB PDB site
Description: Crystal structure of hemagglutinin of A/Chicken/Guangdong/S1311/2010 (H6N6) in complex with avian-like receptor LSTa
Class: viral protein
Keywords: influenza, heamgglutinin, VIRAL PROTEIN
Deposited on 2015-05-29, released 2015-08-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-08-12, with a file datestamp of 2015-08-07.
Experiment type: XRAY
Resolution: 2.78 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus (A/chicken/Guangdong/S1312/2010(H6N2)) [TaxId:1454273]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5bqya_
  • Chain 'B':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:1454274]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5bqyb_
  • Chain 'C':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus (A/chicken/Guangdong/S1312/2010(H6N2)) [TaxId:1454273]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5bqyc_
  • Chain 'D':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:1454274]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5bqyd_
  • Chain 'E':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus (A/chicken/Guangdong/S1312/2010(H6N2)) [TaxId:1454273]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5bqye_
  • Chain 'F':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:1454274]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5bqyf_
  • Heterogens: NAG, SIA, GAL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5bqyA (A:)
    dkicigyhannsttkvdtileknvtvthsvellenqkeerfckisnkapldlrdctlegw
    ilgnprcgilladqswsyiverpnarngicypgtlneaeelkaligsgerverfemfpks
    twtgvntesgvssacplgngpsfyrnllwiiklksseypvirgtfnntgdksilyfwgvh
    hppvtteqnalygsgdryvrmgtesmnfarspeiaarpavngqrgridyfwsilkpgetl
    nvesngnliapwyayrfvnkdskgaifrsnlpiencdatcqttegvirtnktfqnvsplw
    igecpkyvkskslrlatglrnvpq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5bqyB (B:)
    glfgaiagfieggwtgmidgwygyhhensqgsgyaadkestqkaidgitnkvnsiidkmn
    tqfeavghefsnlerridnlnkrmedgfldvwtynaellvllenertldlhdanvknlhe
    kvrsqlrdnandlgngcfefwhkcnnecmesvkngtydypkyqkesrlnrqkiesvklen
    fdvyqgalvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bqyB (B:)
    glfgaiagfieggwtgmidgwygyhhensqgsgyaadkestqkaidgitnkvnsiidkmn
    tqfeavghefsnlerridnlnkrmedgfldvwtynaellvllenertldlhdanvknlhe
    kvrsqlrdnandlgngcfefwhkcnnecmesvkngtydypkyqkesrlnrq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5bqyC (C:)
    dkicigyhannsttkvdtileknvtvthsvellenqkeerfckisnkapldlrdctlegw
    ilgnprcgilladqswsyiverpnarngicypgtlneaeelkaligsgerverfemfpks
    twtgvntesgvssacplgngpsfyrnllwiiklksseypvirgtfnntgdksilyfwgvh
    hppvtteqnalygsgdryvrmgtesmnfarspeiaarpavngqrgridyfwsilkpgetl
    nvesngnliapwyayrfvnkdskgaifrsnlpiencdatcqttegvirtnktfqnvsplw
    igecpkyvkskslrlatglrnvpq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5bqyD (D:)
    glfgaiagfieggwtgmidgwygyhhensqgsgyaadkestqkaidgitnkvnsiidkmn
    tqfeavghefsnlerridnlnkrmedgfldvwtynaellvllenertldlhdanvknlhe
    kvrsqlrdnandlgngcfefwhkcnnecmesvkngtydypkyqkesrlnrqkiesvklen
    fdvyqgalvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bqyD (D:)
    glfgaiagfieggwtgmidgwygyhhensqgsgyaadkestqkaidgitnkvnsiidkmn
    tqfeavghefsnlerridnlnkrmedgfldvwtynaellvllenertldlhdanvknlhe
    kvrsqlrdnandlgngcfefwhkcnnecmesvkngtydypkyqkesrlnrqki
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5bqyE (E:)
    dkicigyhannsttkvdtileknvtvthsvellenqkeerfckisnkapldlrdctlegw
    ilgnprcgilladqswsyiverpnarngicypgtlneaeelkaligsgerverfemfpks
    twtgvntesgvssacplgngpsfyrnllwiiklksseypvirgtfnntgdksilyfwgvh
    hppvtteqnalygsgdryvrmgtesmnfarspeiaarpavngqrgridyfwsilkpgetl
    nvesngnliapwyayrfvnkdskgaifrsnlpiencdatcqttegvirtnktfqnvsplw
    igecpkyvkskslrlatglrnvpq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5bqyF (F:)
    glfgaiagfieggwtgmidgwygyhhensqgsgyaadkestqkaidgitnkvnsiidkmn
    tqfeavghefsnlerridnlnkrmedgfldvwtynaellvllenertldlhdanvknlhe
    kvrsqlrdnandlgngcfefwhkcnnecmesvkngtydypkyqkesrlnrqkiesvklen
    fdvyqgalvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bqyF (F:)
    glfgaiagfieggwtgmidgwygyhhensqgsgyaadkestqkaidgitnkvnsiidkmn
    tqfeavghefsnlerridnlnkrmedgfldvwtynaellvllenertldlhdanvknlhe
    kvrsqlrdnandlgngcfefwhkcnnecmesvkngtydypkyqkesrlnrqkie