PDB entry 5bqe

View 5bqe on RCSB PDB site
Description: Crystal structure of Norrin in complex with the cysteine-rich domain of Frizzled 4 -Methylated form
Class: signaling protein
Keywords: Wnt signalling pathway, Norrie disease protein, Glycoprotein, G protein coupled receptor, SIGNALING PROTEIN
Deposited on 2015-05-28, released 2015-07-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Norrin
  Species: Homo sapiens [TaxId:9606]
  Gene: NDP, EVR2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q00604 (Start-111)
• Chain 'B':
  Compound: Norrin
  Species: Homo sapiens [TaxId:9606]
  Gene: NDP, EVR2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q00604 (Start-111)
• Chain 'C':
  Compound: Frizzled-4
  Species: Homo sapiens [TaxId:9606]
  Gene: FZD4
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9ULV1
  Domains in SCOPe 2.08: d5bqec_
• Heterogens: PG0, NAG, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >5bqeC (C:)
  dtgerrcdpirismcqnlgynvtkmpnlvghelqtdaelqlttftpliqygcssqlqffl
  csvyvpmctekinipigpcggmclsvkrrcepvlkefgfawpeslncskfppqndhnhmc
  megpgdeevplphktpiqpgegtlevlfq
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >5bqeC (C:)
  rrcdpirismcqnlgynvtkmpnlvghelqtdaelqlttftpliqygcssqlqfflcsvy
  vpmctekinipigpcggmclsvkrrcepvlkefgfawpeslncskfppqndhnhmcmegp
  gd