PDB entry 5bqc

View 5bqc on RCSB PDB site
Description: Crystal structure of Norrin in complex with the cysteine-rich domain of Frizzled 4 and sucrose octasulfate
Class: signaling protein
Keywords: Wnt signalling pathway, Norrie disease protein, Glycoprotein, G protein coupled receptor, SIGNALING PROTEIN
Deposited on 2015-05-28, released 2015-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Norrin
    Species: Homo sapiens [TaxId:9606]
    Gene: NDP, EVR2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Frizzled-4
    Species: Homo sapiens [TaxId:9606]
    Gene: FZD4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5bqcb_
  • Heterogens: NAG, SCR

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >5bqcB (B:)
dtgerrcdpirismcqnlgynvtkmpnlvghelqtdaelqlttftpliqygcssqlqffl
csvyvpmctekinipigpcggmclsvkrrcepvlkefgfawpeslncskfppqndhnhmc
megpgdeevplphktpiqpgegtlevlfq

    Sequence, based on observed residues (ATOM records): (download) 
    >5bqcB (B:)
rrcdpirismcqnlgynvtkmpnlvghelqtdaelqlttftpliqygcssqlqfflcsvy
vpmctekinipigpcggmclsvkrrcepvlkefgfawpeslncskfppqndhnhmcmegp
gdee