PDB entry 5bp5

View 5bp5 on RCSB PDB site
Description: Crystal structure of HA17-HA33-IPT
Class: protein binding
Keywords: Botulinum neurotoxin A, Hemagglutinin, IPTG, PROTEIN BINDING
Deposited on 2015-05-27, released 2015-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ha-33
    Species: Clostridium botulinum [TaxId:1491]
    Gene: HA-33, ha33, ha34
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q45871 (Start-291)
      • expression tag (292)
    Domains in SCOPe 2.07: d5bp5a1, d5bp5a2, d5bp5a3
  • Chain 'B':
    Compound: ha-33
    Species: Clostridium botulinum [TaxId:1491]
    Gene: HA-33, ha33, ha34
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q45871 (Start-291)
      • expression tag (292)
    Domains in SCOPe 2.07: d5bp5b1, d5bp5b2, d5bp5b3
  • Chain 'C':
    Compound: ha-17
    Species: Clostridium botulinum [TaxId:1491]
    Gene: ha17, HA-17
    Database cross-references and differences (RAF-indexed):
  • Heterogens: IPT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5bp5A (A:)
    ehysviqnslndkivtisckadtnlffyqvagnvslfqqtrnylerwrliydsnkaayki
    ksmdihntnlvltwnapthnistqqdsnadnqywlllkdignnsfiiasyknpnlvlyad
    tvarnlklstlnnsnyikfiiedyiisdlnnftckispildlnkvvqqvdvtnlnvnlyt
    wdygrnqkwtiryneekaayqffntilsngvltwifsngntvrvsssndqnndaqywlin
    pvsdtdetytitnlrdttkaldlyggqtangtaiqvfnyhgddnqkwnirnppgsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bp5A (A:)
    nslndkivtisckadtnlffyqvagnvslfqqtrnylerwrliydsnkaaykiksmdihn
    tnlvltwnapthnistqqdsnadnqywlllkdignnsfiiasyknpnlvlyadtvarnlk
    lstlnnsnyikfiiedyiisdlnnftckispildlnkvvqqvdvtnlnvnlytwdygrnq
    kwtiryneekaayqffntilsngvltwifsngntvrvsssndqnndaqywlinpvsdtde
    tytitnlrdttkaldlyggqtangtaiqvfnyhgddnqkwnirnpp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5bp5B (B:)
    ehysviqnslndkivtisckadtnlffyqvagnvslfqqtrnylerwrliydsnkaayki
    ksmdihntnlvltwnapthnistqqdsnadnqywlllkdignnsfiiasyknpnlvlyad
    tvarnlklstlnnsnyikfiiedyiisdlnnftckispildlnkvvqqvdvtnlnvnlyt
    wdygrnqkwtiryneekaayqffntilsngvltwifsngntvrvsssndqnndaqywlin
    pvsdtdetytitnlrdttkaldlyggqtangtaiqvfnyhgddnqkwnirnppgsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bp5B (B:)
    slndkivtisckadtnlffyqvagnvslfqqtrnylerwrliydsnkaaykiksmdihnt
    nlvltwnapthnistqqdsnadnqywlllkdignnsfiiasyknpnlvlyadtvarnlkl
    stlnnsnyikfiiedyiisdlnnftckispildlnkvvqqvdvtnlnvnlytwdygrnqk
    wtiryneekaayqffntilsngvltwifsngntvrvsssndqnndaqywlinpvsdtdet
    ytitnlrdttkaldlyggqtangtaiqvfnyhgddnqkwnirnpp
    

  • Chain 'C':
    No sequence available.