PDB entry 5bp0

View 5bp0 on RCSB PDB site
Description: X-ray crystal structure of Lymnaea stagnalis acetylcholine binding protein (Ls-AChBP) in complex with 5-Fluoronicotine (TI-4650)
Class: acetylcholine binding protein
Keywords: AChBP, nicotine, acetylcholine, ACETYLCHOLINE BINDING PROTEIN
Deposited on 2015-05-27, released 2015-06-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-06-24, with a file datestamp of 2015-06-19.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58154 (8-End)
      • expression tag (7)
    Domains in SCOPe 2.07: d5bp0a1, d5bp0a2
  • Chain 'B':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58154 (8-End)
      • expression tag (6-7)
    Domains in SCOPe 2.07: d5bp0b1, d5bp0b2
  • Chain 'C':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58154 (8-End)
      • expression tag (0-7)
    Domains in SCOPe 2.07: d5bp0c1, d5bp0c2
  • Chain 'D':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58154 (8-End)
      • expression tag (5-7)
    Domains in SCOPe 2.07: d5bp0d1, d5bp0d2
  • Chain 'E':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58154 (8-End)
      • expression tag (6-7)
    Domains in SCOPe 2.07: d5bp0e1, d5bp0e2
  • Chain 'F':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58154 (8-End)
      • expression tag (7)
    Domains in SCOPe 2.07: d5bp0f1, d5bp0f2
  • Chain 'G':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58154 (8-End)
      • expression tag (5-7)
    Domains in SCOPe 2.07: d5bp0g1, d5bp0g2
  • Chain 'H':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58154 (8-End)
      • expression tag (4-7)
    Domains in SCOPe 2.07: d5bp0h1, d5bp0h2
  • Chain 'I':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58154 (8-End)
      • expression tag (5-7)
    Domains in SCOPe 2.07: d5bp0i1, d5bp0i2
  • Chain 'J':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58154 (8-End)
      • expression tag (7)
    Domains in SCOPe 2.07: d5bp0j1, d5bp0j2
  • Heterogens: PO4, FN1, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5bp0A (A:)
    dykddddkldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvf
    wqqttwsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevl
    ympsirqrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfe
    ildvtqkknsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bp0A (A:)
    kldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpdseyfsqysrfeildvtqkknsvty
    sccpeayedvevslnfrkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5bp0B (B:)
    dykddddkldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvf
    wqqttwsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevl
    ympsirqrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfe
    ildvtqkknsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bp0B (B:)
    dkldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttw
    sdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsir
    qrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtq
    kknsvtyccpeayedvevslnfrkk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5bp0C (C:)
    dykddddkldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvf
    wqqttwsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevl
    ympsirqrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfe
    ildvtqkknsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bp0C (C:)
    dykddddkldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvf
    wqqttwsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevl
    ympsirqrfscdvsgvdtesgatcrikigswthhsreisvdpsddseyfsqysrfeildv
    tqkknsvtysccpeayedvevslnfrkk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5bp0D (D:)
    dykddddkldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvf
    wqqttwsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevl
    ympsirqrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfe
    ildvtqkknsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bp0D (D:)
    ddkldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqtt
    wsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsi
    rqrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvt
    qkknsvtysccpeayedvevslnfrkk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5bp0E (E:)
    dykddddkldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvf
    wqqttwsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevl
    ympsirqrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfe
    ildvtqkknsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bp0E (E:)
    dkldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttw
    sdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsir
    qrfscdvsgvdtesgatcrikigswthhsreisvdpsddseyfsqysrfeildvtqkkns
    vtysccpeayedvevslnfrkk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5bp0F (F:)
    dykddddkldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvf
    wqqttwsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevl
    ympsirqrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfe
    ildvtqkknsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bp0F (F:)
    kldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdpseyfsqysrfeildvtqkknsvtay
    edvevslnfrkkg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5bp0G (G:)
    dykddddkldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvf
    wqqttwsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevl
    ympsirqrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfe
    ildvtqkknsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bp0G (G:)
    ddkldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqtt
    wsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsi
    rqrfscdvsgvdtesgatcrikigswthhsreisvdpseyfsqysrfeildvtqkknsvt
    ysccpeayedvevslnfrkkg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5bp0H (H:)
    dykddddkldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvf
    wqqttwsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevl
    ympsirqrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfe
    ildvtqkknsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bp0H (H:)
    dddkldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqt
    twsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlymps
    irqrfscdvsgvdtesgatcrikigswthhsreisvdpdseyfsqysrfeildvtqkkns
    vtysccpeayedvevslnfrk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5bp0I (I:)
    dykddddkldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvf
    wqqttwsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevl
    ympsirqrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfe
    ildvtqkknsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bp0I (I:)
    ddkldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqtt
    wsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsi
    rqrfscdvsgvdtesgatcrikigswthhsreisvdpsddseyfsqysrfeildvtqkkn
    svtysccpeayedvevslnfrkk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5bp0J (J:)
    dykddddkldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvf
    wqqttwsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevl
    ympsirqrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfe
    ildvtqkknsvtysccpeayedvevslnfrkkgrseil
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bp0J (J:)
    kldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
    drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
    rfscdvsgvdtesgatcrikigswthhsreisvdptnsddseyfsqysrfeildvtqkkn
    svtysccpeayedvevslnfrkk