PDB entry 5bok

View 5bok on RCSB PDB site
Description: Ferredoxin component of 3-nitrotoluene dioxygenase from Diaphorobacter sp. strain DS2
Class: metal binding protein
Keywords: electron transport protein, Rieske iron sulfur cluster, ferredoxin, METAL BINDING PROTEIN
Deposited on 2015-05-27, released 2016-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-07-27, with a file datestamp of 2016-07-22.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin
    Species: Diaphorobacter sp. DS2 [TaxId:1302548]
    Gene: mntAb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5boka_
  • Heterogens: FES, FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5bokA (A:)
    msenwidaaardevpegdviginivgkeialyevageiyatdntcthgaarmsdgflegr
    eiecplhqgrfdvctgkalctpltqdiktypvkienmrvmlkld
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bokA (A:)
    enwidaaardevpegdviginivgkeialyevageiyatdntcthgaarmsdgflegrei
    ecplhqgrfdvctgkalctpltqdiktypvkienmrvmlkld