PDB entry 5bnz

View 5bnz on RCSB PDB site
Description: Crystal structure of Glutamine-tRNA ligase /Glutaminyl-tRNA synthetase (GlnRS) from Pseudomonas aeruginosa
Class: ligase
Keywords: SSGCID, Pseudomonas aeruginosa, Glutamine--tRNA ligase, Glutaminyl-tRNA synthetase (GlnRS), Structural Genomics, Seattle Structural Genomics Center for Infectious Disease
Deposited on 2015-05-26, released 2015-06-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-06-03, with a file datestamp of 2015-05-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamine--tRNA ligase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: glnS, PA1794
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5bnza1, d5bnza2
  • Chain 'B':
    Compound: Glutamine--tRNA ligase
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: glnS, PA1794
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5bnzb1, d5bnzb2
  • Heterogens: SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5bnzA (A:)
    mahhhhhhmskpettaapnflrqivqadldagkhakivtrfppepngylhighaksicln
    fglaqefagdchlrfddtnpakedqeyidaieadikwlgfqwsgevcyasnyfdqlhawa
    velikagkafvcdlgpeemreyrgtltepgrnspyrdrsveenldlfarmkagefpdgar
    slrakidmgspnmnlrdpilyrirhahhhqtgdkwciypsydfthgqsdaiegithsict
    lefedhrplyewflanlpvpaqprqyefsrlnlnytvtskrklkqlvdeghvsgwddprm
    stlsgyrrrgytpesirnfcemigvnrasgvvdigmlefsirdhldatapramcvlkplk
    vvitnypegqvenlelprhpkedmgvrvlpfgrelfidagdfeevppagykrlipggevr
    lrgsyviradeaikdadgnivelrcsydpdtlgknpegrkvkgvihwvpaegsvecevrl
    ydrlfrsanpekaeeggsfldninadslqvlagcraepslgqanpedrfqferegyfvad
    lkdsrpgkpvfnrtvtlrdswgqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bnzA (A:)
    aapnflrqivqadldagkhakivtrfppepngylhighaksiclnfglaqefagdchlrf
    ddtnpakedqeyidaieadikwlgfqwsgevcyasnyfdqlhawavelikagkafvcdlg
    peemreyrgtltepgrnspyrdrsveenldlfarmkagefpdgarslrakidmgspnmnl
    rdpilyrirhahhhqtgdkwciypsydfthgqsdaiegithsictlefedhrplyewfla
    nlpvpaqprqyefsrlnlnytvtskrklkqlvdeghvsgwddprmstlsgyrrrgytpes
    irnfcemigvnrasgvvdigmlefsirdhldatapramcvlkplkvvitnypegqvenle
    lprhpkedmgvrvlpfgrelfidagdfeevppagykrlipggevrlrgsyviradeaikd
    adgnivelrcsydpdtlgknpegrkvkgvihwvpaegsvecevrlydrlfrsanpekaee
    ggsfldninadslqvlagcraepslgqanpedrfqferegyfvadlkdsrpgkpvfnrtv
    tlrdswgq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5bnzB (B:)
    mahhhhhhmskpettaapnflrqivqadldagkhakivtrfppepngylhighaksicln
    fglaqefagdchlrfddtnpakedqeyidaieadikwlgfqwsgevcyasnyfdqlhawa
    velikagkafvcdlgpeemreyrgtltepgrnspyrdrsveenldlfarmkagefpdgar
    slrakidmgspnmnlrdpilyrirhahhhqtgdkwciypsydfthgqsdaiegithsict
    lefedhrplyewflanlpvpaqprqyefsrlnlnytvtskrklkqlvdeghvsgwddprm
    stlsgyrrrgytpesirnfcemigvnrasgvvdigmlefsirdhldatapramcvlkplk
    vvitnypegqvenlelprhpkedmgvrvlpfgrelfidagdfeevppagykrlipggevr
    lrgsyviradeaikdadgnivelrcsydpdtlgknpegrkvkgvihwvpaegsvecevrl
    ydrlfrsanpekaeeggsfldninadslqvlagcraepslgqanpedrfqferegyfvad
    lkdsrpgkpvfnrtvtlrdswgqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bnzB (B:)
    aapnflrqivqadldagkhakivtrfppepngylhighaksiclnfglaqefagdchlrf
    ddtnpakedqeyidaieadikwlgfqwsgevcyasnyfdqlhawavelikagkafvcdlg
    peemreyrgtltepgrnspyrdrsveenldlfarmkagefpdgarslrakidmgspnmnl
    rdpilyrirhahhhqtgdkwciypsydfthgqsdaiegithsictlefedhrplyewfla
    nlpvpaqprqyefsrlnlnytvtskrklkqlvdeghvsgwddprmstlsgyrrrgytpes
    irnfcemigvnrasgvvdigmlefsirdhldatapramcvlkplkvvitnypegqvenle
    lprhpkedmgvrvlpfgrelfidagdfeevppagykrlipggevrlrgsyviradeaikd
    adgnivelrcsydpdtlgknpegrkvkgvihwvpaegsvecevrlydrlfrsanpekaee
    ggsfldninadslqvlagcraepslgqanpedrfqferegyfvadlkdsrpgkpvfnrtv
    tlrdswgq