PDB entry 5bnr

View 5bnr on RCSB PDB site
Description: E. coli Fabh with small molecule inhibitor 2
Class: Transferase/Transferase Inhibitor
Keywords: Fabh, Fatty acid synthesis, anti-bacterials, Transferase-Transferase Inhibitor complex
Deposited on 2015-05-26, released 2016-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-28, with a file datestamp of 2016-09-23.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 3
    Species: Escherichia coli [TaxId:83333]
    Gene: fabH, b1091, JW1077
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5bnra1, d5bnra2
  • Heterogens: 4VL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5bnrA (A:)
    mytkiigtgsylpeqvrtnadlekmvdtsdewivtrtgirerhiaapnetvstmgfeaat
    raiemagiekdqiglivvattsathafpsaacqiqsmlgikgcpafdvaaacagftyals
    vadqyvksgavkyalvvgsdvlartcdptdrgtiiifgdgagaavlaaseepgiisthlh
    adgsygelltlpnadrvnpensihltmagnevfkvavtelahivdetlaannldrsqldw
    lvphqanlriisatakklgmsmdnvvvtldrhgntsaasvpcaldeavrdgrikpgqlvl
    leafgggftwgsalvrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bnrA (A:)
    mytkiigtgsylpeqvrtnadlekmvdtsdewivtrtgirerhiaapnetvstmgfeaat
    raiemagiekdqiglivvattsathafpsaacqiqsmlgikgcpafdvaaacagftyals
    vadqyvksgavkyalvvgsdvlartcdptdrgtiiifgdgagaavlaaseepgiisthlh
    adgsygelltlpnaihltmagnevfkvavtelahivdetlaannldrsqldwlvphqanl
    riisatakklgmsmdnvvvtldrhgntsaasvpcaldeavrdgrikpgqlvlleafgggf
    twgsalvrf