PDB entry 5bn8

View 5bn8 on RCSB PDB site
Description: Crystal structure of nucleotide-free human Hsp70 NBD.
Class: hydrolase
Keywords: Hydrolase, ATP hydrolysis activity
Deposited on 2015-05-25, released 2016-09-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-14, with a file datestamp of 2016-09-09.
Experiment type: XRAY
Resolution: 1.34 Å
R-factor: N/A
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heat shock 70 kda protein 1a
    Species: Homo sapiens [TaxId:9606]
    Gene: HSPA1A, HSPA1, HSX70
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5bn8a1, d5bn8a2
  • Heterogens: EPE, MG, PO4, CL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5bn8A (A:)
    makaaaigidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqva
    lnpqntvfdakrligrkfgdpvvqsdmkhwpfqvindgdkpkvqvsykgetkafypeeis
    smvltkmkeiaeaylgypvtnavitvpayfndsqrqatkdagviaglnvlriineptaaa
    iaygldrtgkgernvlifdlgggtfdvsiltiddgifevkatagdthlggedfdnrlvnh
    fveefkrkhkkdisqnkravrrlrtacerakrtlssstqasleidslfegidfytsitra
    rfeelcsdlfrstlepvekalrdakldkaqihdlvlvggstripkvqkllqdffngrdln
    ksinpdeavaygaavqaailmgdksenv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bn8A (A:)
    aaaigidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvalnp
    qntvfdakrligrkfgdpvvqsdmkhwpfqvindgdkpkvqvsykgetkafypeeissmv
    ltkmkeiaeaylgypvtnavitvpayfndsqrqatkdagviaglnvlriineptaaaiay
    gldrtgkgernvlifdlgggtfdvsiltiddgifevkatagdthlggedfdnrlvnhfve
    efkrkhkkdisqnkravrrlrtacerakrtlssstqasleidslfegidfytsitrarfe
    elcsdlfrstlepvekalrdakldkaqihdlvlvggstripkvqkllqdffngrdlnksi
    npdeavaygaavqaailmg